Conserved Protein Domain Family
phenyl_P_gamma

?
TIGR02725: phenyl_P_gamma 
phenylphosphate carboxylase, gamma subunit
Members of this protein family are the gamma subunit of phenylphosphate carboxylase. Phenol (methyl-benzene) is converted to phenylphosphate, then para-carboxylated by this four-subunit enzyme, with the release of phosphate, to 4-hydroxybenzoate. The enzyme contains neither biotin nor thiamin pyrophosphate. The gamma subunit has no known homologs.
Statistics
?
PSSM-Id: 131772
View PSSM: TIGR02725
Aligned: 2 rows
Threshold Bit Score: 156.763
Threshold Setting Gi: 38228893
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38228893  1 MNQWEVFVMDPAELPEGKQLELSVRTLNPGLKKYTYQRVRAEVSPALDKFPDQLQVRLGRGQLSPQRFSIRIIETVQRMP 80
gi 56313237  1 MNQWEVFVMDLAELPEGTELELSVRTLNPGLKKYTYQRVKAELSNALDKFPDRLQVRFGRGQLCSQQFSIRIIEQVQRMP 80

               ....
gi 38228893 81 AKYL 84
gi 56313237 81 AKYL 84
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap