Conserved Protein Domain Family
carot_isom

?
TIGR02730: carot_isom 
carotene isomerase
Members of this family, including sll0033 (crtH) of Synechocystis sp. PCC 6803, catalyze a cis-trans isomerization of carotenes to the all-trans lycopene, a reaction that can also occur non-enzymatically in light through photoisomerization. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131777
View PSSM: TIGR02730
Aligned: 4 rows
Threshold Bit Score: 944.239
Threshold Setting Gi: 19550437
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33632604   7 WDAVVIGSGIGGLVTASQLAAKGARTLVLERYLIPGGSGGAFKREGYTFDVGASMIFGFGEKGYTNLLTRALADVGEHCE 86
gi 1001311    7 YDAIVIGSGIGGLVTATQLVSKGLKVLVLERYLIPGGSAGYFEREGYRFDVGASMIFGFGDRGTTNLLTRALAAVGQALE 86
gi 17131155  13 FDVIVIGSGIGGLVTATQLATKGAKVLVLESYIIPGGSAGYFERQGYRFDVGASMIFGLGNRGTTNLLTRALQAVNSSVD 92
gi 19550437  98 YDAIVIGSGIGGLVAATQLAVKGAKVLVLEKYVIPGGSSGFYERDGYKFDVGSSVMFGFSDKGNLNLITQALAAVGRKLE 177
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33632604  87 TIPDQAQLEYHMPGGLNIAVDRDYETFIADLSARFPHEATGVRRFYDTCWQVFNCLDAMPLLSLEDPAYLTKVFFKAPLA 166
gi 1001311   87 TLPDPVQIHYHLPGGLDPKVHREYEAFLQELIAKFPQEAQGIRRFYDECWQVFNCLNTMELLSLEEPRYLMRVFFQHPGA 166
gi 17131155  93 AIADPVQIHYHLPNNLNLKVDRVYDKFLQNLAAYFPHEKEGIRGFYDECWQVFKCLNRMELLSLEEPRYLLRSFLQHPLA 172
gi 19550437 178 VIPDPTTVHFHLPNDLSVRIHREYDDFIEELVSKFPHEKEGIIKFYSECWKIFNSLNSLELKSLEEPIYLFGQFFKKPLE 257
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33632604 167 CLGLARWLPFNVGAVARQHINDEQLLKFIDIECFCWSVMPADRTPMINAGMVFSDRHAGGINYPRGGVGVIAEKLVHGLE 246
gi 1001311  167 CLGLVKYLPQNVGDIARRHIQDPDLLKFIDMECYCWSVVPADLTPMINAGMVFSDRHYGGINYPKGGVGQIAESLVAGLE 246
gi 17131155 173 CLGLLKYLPQNAGDIARRYIKDPELLKFIDIECYCWSVVPAAMTPMINAGMVFSDRHYGGVNYPKGGVGQIAQKLVEGLE 252
gi 19550437 258 CLTLAYYLPQNAGSIARKYIRDPGLLSFIDAECFIVSTVNALQTPMINASMVLCDRHFGGINYPVGGVGEIAKSLAKGLD 337
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33632604 247 RHGGAIRYKARVTKVLLENGEAVGVKLADGETIRAKRVISNATRWDTFSgqddgstragqALVDEANTPKKEAFWRRRYV 326
gi 1001311  247 KFGGKIRYGARVTKIIQENNQAIGVELANGEKIYGRRIVSNATRWDTFG-----------ALTGDQPLPGKEKRWRRNYQ 315
gi 17131155 253 KAGGEIRYQAKVAKIITEKDCAVGVQLTNGEIYRGKRIVSNATRWDTFD-----------KLLPVDQIPSNEKKWQQNYK 321
gi 19550437 338 DHGSQILYRANVTSIILDNGKAVGVKLSDGRKFYAKTIVSNATRWDTFG-----------KLLKAENLPKEEENFQKAYV 406
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33632604 327 PSPSFLSLHLGVRADLIPAGTHCHHLLLED-WNRMEDEQGVIFVSMPSLLDPDLAPAGHHIVHTFTPSSMEAWQGLSPTD 405
gi 1001311  316 QSPSFLSLHLGVEADLLPEGTECHHILLED-WDDLEKEQGTIFVSIPTLLDPSLAPDGYHIIHTFTPSWLESWQNLSPQE 394
gi 17131155 322 KSPSFLSLHIGVKESVLPQGTECHHIILED-WQNMTQPEGTLFVSIPTLLDPELAPEGYHIIHAFTPNWMNDWHGLSVSD 400
gi 19550437 407 KAPSFLSIHMGVKADVLPPDTDCHHFVLEDdWTNLEKPYGSIFLSIPTVLDSSLAPEGHHILHIFTTSSIEDWEGLSPKD 486
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33632604 406 YRAKKEADAARLIQRLEA-ILPGLSEAITHKEIGTPRSHRRFLGRFQGSYGPIPAMQLPGLLPMPFNRTGVPNLYCVGDS 484
gi 1001311  395 YEAKKEADSGKLIDRLEA-IFPGLDRALDYMEIGTPRSHRRFLGRQNGTYGPIPRRRLPGLLPMPFNRTAIPGLYCVGDS 473
gi 17131155 401 YEAKKEETAWRIIDRLEK-IFPGLDAGLDYLEVGTPRTHRRFLGREDGTYGPIPRRKLRGLLSMPFNRTAIKGLYCVGDS 479
gi 19550437 487 YEAKKEVVAERIISRLEKtLFPGLKSSILFKEVGTPKTHRRYLARDSGTYGPMPRGTPKGLLGMPFNTTAIDGLYCVGDS 566
                       490       500
                ....*....|....*....|....*.
gi 33632604 485 CFPGQGLNAVAFSGFACAHRVGADLG 510
gi 1001311  474 TFPGQGLNAVAFSGFACAHRLAVDLG 499
gi 17131155 480 TFPGQGLNAVAFSGFACAHRIAVDLG 505
gi 19550437 567 CFPGQGVIAVAFSGVMCAHRVAADLG 592
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap