Conserved Protein Domain Family
phytoene_desat

?
TIGR02731: phytoene_desat 
phytoene desaturase
Plants and cyanobacteria (and, supposedly, Chlorobium tepidum) have a conserved pathway from two molecules geranylgeranyl-PP to one of all-trans-lycopene. Members of this family are the enzyme pytoene desaturase (also called phytoene dehydrogenase). This model does not include the region of the chloroplast transit peptide in plants. A closely related family, excluded by this model, is zeta-carotene desaturase, another enzyme in the same pathway. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 131778
View PSSM: TIGR02731
Aligned: 5 rows
Threshold Bit Score: 915.773
Threshold Setting Gi: 1345838
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130922   2 RVAIAGAGLAGLSCAKYLTDAGHTPIVLERRDVLGGLVAAWKDSDGDWYETGLHAFFGAYPNMLQLLKELGIEDRLQWKE 81
gi 2407898   73 RVVIAGAGLAGLSAAKYLSDAGHIPIVLEARDVLGGKVAAWKDEDGDWYETGLHIFFGAYPNIQRLLKELNISDRLQWKS 152
gi 1345838   98 QVVVAGAGLAGLSTAKYLADAGHKPILLEARDVLGGKVAAWKDEDGDWYETGLHIFFGAYPNIQNLFGELRIEDRLQWKE 177
gi 22295286   2 RVAIAGGGLAGLACAKYLVDAGHTPIVFERANVLGGLVAAWQDADGDWVETGLHAFFGAYPNMLQLLEELGISDRLQWKR 81
gi 33639388   2 RVAIAGAGLAGLSCAKYLADAGHTPIVVEARDVLGGKVAAWKDEDGDWYETGLHIFFGAYPNMLQLFKELNIEDRLQWKS 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130922  82 HTLIFNQPDKPGTLSRFDVPD-IPSPFNIIASILRNNDMLTWEQKIRFAIGLLPAIVRGQKYVEEMDKYSFSDWLKRQGV 160
gi 2407898  153 HSMIFAMQDKPGQFSRFEFPD-IPAPWNGVVAILRNNEMLSWTEKIKFAIGLLRPIIFGQKYVEEQDELTVTQWMEKQGV 231
gi 1345838  178 HSMIFAMPNKPGEFSRFDFPEtLPAPINGIWAILRNNEMLTWPEKVKFAIGLLPAMVGGQPYVEAQDGLTVSEWMKKQGV 257
gi 22295286  82 HALIFNQPEKPGVLSWFDVPD-IPAPFNVLLSILRNNDMLTWEQKLRFALGLWPAIVRGQKYVEAMDQYTLLEWLRRQGI 160
gi 33639388  82 HSMIFNQQDEPGTYSRFDFPD-LPAPVNGVAAILGNNDMLTWPEKISFGLGLVPAMLRGQGYVEECDKYSWTEWLRVHNI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130922 161 GERVASDVFIAASKALTFINPDEVSSTILLTALNRFLQERYGSKIAFLDGSPTERLCQPIVDYITERGGEVRLNAPLKEI 240
gi 2407898  232 PSRVNDEVFIAMAKALNFIDPDELSMTVVLTALNRFLQERHGSKMAFLDGAPPERLCEPMVNYFTSRGGELRMNARLKQI 311
gi 1345838  258 PDRVNDEVFIAMSKALNFINPDELSMQCILIALNRFLQEKHGSKMAFLDGNPPERLCMPIVDHIRSRGGEVRLNSRIKKI 337
gi 22295286 161 DERVNSDIFIAASKALTFLNPDEVSATIPLTAMNRFLRERYGSKIAFLDGAPPERLCQPIVDYVTARGGEVHTNVALREI 240
gi 33639388 161 PERVNDEVFLAMSKALNFIDPDEISATVVLTALNRFLQEKSGSKMAFLDGAPPERLCQPVVEHIESLGGEVHLDSPLREI 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130922 241 LLNPDGTVKGFLLRGLNgepdeVITADFYVSAMAVDPLKVMLPQPWQQMEFFQKLEGLEGVPVINLHLWFDRKLT-DIDH 319
gi 2407898  312 VLNEDNSVKHFELLNGE-----IVEGDAYMSAMPVDIMKKLMPQPWKNVPFFQKPNGLEGVPVINIHIWFDRKLS-TVDH 385
gi 1345838  338 ELNPDGTVKHFALSDGT-----QITGDAYVCATPVDIFKLLVPQEWSEITYFKKLEKLVGVPVINVHIWFDRKLNnTYDH 412
gi 22295286 241 VLKEDLSVQSFVMADREgqrrfEVTADAYVSAMSVDAIKLLLPKPWQDLPFFQKLNGLEGVPVINVQIWFDRKLP-TVDH 319
gi 33639388 241 KLNEDGSVAAFHIGGVKgkdsfDLTADAYVSALPVDPFKLLLPKPWKQMEVFRKLDGLRGVPVINLHLWFDRKLT-DIDH 319
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130922 320 LLFSRSPLLSVYADMSNTCREYANPDRSMLELVLAPAKDWISKSDEEIVSATMVELEKLFPDHFKGD-NPAKLLKSHVVK 398
gi 2407898  386 LLFSRSELLSVYADMSTTCKEYSDDKASMLELVFAPAADWIGRPDSEIVDATMKELEKLFPNEIKADqSLAKIRKSKVIK 465
gi 1345838  413 LLFSRSSLLSVYADMSVTCKEYYDPNRSMLELVFAPADEWIGRSDTEIIDATMEELAKLFPDEIAADqSKAKILKYHIVK 492
gi 22295286 320 LLFSRSPLLSVYADMSETCRGYADPDKSMLELVLAPAAEWIGRSDEDIIEATLAELAKLFPNHLP---EPAKVLKTAVVK 396
gi 33639388 320 LLFSRSPLLSVYADMSITCKEYEDPDKSMLELVFAPAKDWIGRPDEEIIEATMSELHKLFPMHFGGD-NPATLLKYKVVK 398
                       410       420       430       440       450
                ....*....|....*....|....*....|....*....|....*....|....*.
gi 17130922 399 TPRSVYKATPGRQQYRPAQKTPIANFFLSGSYTMQRYLGSMEGAVLSGKLTAQAIC 454
gi 2407898  466 TPLSVYKSTAGREKYRPSQKTPIPNFYLAGDYTKQKYLASMEGAVFSGKLACEQVV 521
gi 1345838  493 TPRSVYKTVPNCEPCRPLQRSPIEGFYLAGDYTKQKYLASMEGAVLSGKLCAQSIV 548
gi 22295286 397 TPRSVYKATPGRQAFRPHQATPIPNFFLSGSYTLQPYLGSMEGAVLSGKLTAQAIA 452
gi 33639388 399 TPLSVYKTTPGCQQLRPDQTTPIKNFFLAGDYTMQRYLASMEGAVLSGKLCAGAVD 454
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap