Conserved Protein Domain Family
purC_vibrio

?
TIGR02735: purC_vibrio 
phosphoribosylaminoimidazole-succinocarboxamide synthase, Vibrio type
Members of this protein family appear to represent a novel form of phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR synthetase), significantly different in sequence and gap pattern from a form (see TIGR00081) shared by a broad range of bacteria and eukaryotes. Members of this family are found within the gammaproteobacteria in the genera Vibrio, Shewanella, and Colwellia, and also (reported as a fragment) in the primitive eukarote Guillardia theta. [Purines, pyrimidines, nucleosides, and nucleotides, Purine ribonucleotide biosynthesis]
Statistics
?
PSSM-Id: 131782
View PSSM: TIGR02735
Aligned: 3 rows
Threshold Bit Score: 730.939
Threshold Setting Gi: 40063125
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39932005   2 SLADQVLAVNDDLPIRTHQPVHSGKVRSVYWLTEQDSRRLIKEKGYPVAEDAPLAIMVISDRISAFDCIWHAEGGVHGVP 81
gi 46913091   2 SLADQVLAVNDDLPIRTDKPVHSGKVRSVYWLTEADSRRLIEEKGYNVAPDAPLAIMVISDRISAFDCIWHGEGGMKGVP 81
gi 40063125   1 -MSAQFLERNDDFNVPTDEAVHSGKVRSVYWLKPEDSRRLIEKRNYPVSHDAELAILIVSDRLSAFDCIWRAEGGLNGVP 79
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39932005  82 GKGAALNAISNHWFKLFKQHGLAESHILDIPHPFVWIVQKARPIKIEAICRQYITGSMWRAYAKGEREFCGITLPEGLEK 161
gi 46913091  82 GKGAALNAISNHWFKLFRDNDLAESHILDIPHPFIWIVQKAKPVMIEAICRQYITGSMWRSYSKGERDFCGIEVPEGLNK 161
gi 40063125  80 GKGAALNAVSLEWFNAFAEAGLARSHILEAPHPLVWVVQRAKPVKIEAIARQYITGSLWRAYAKGERVFCGNDLPNHLAE 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39932005 162 DSQLPELLMTPSTKGILRGIPGVPEADDVNISRQDIEANYAAFNFNQPQDIDHYETLLKQGFAVISEALKSVGQLFVDTK 241
gi 46913091 162 DQKLPELLITPSTKGILEGIPGVPAVDDVNITRKNIEENFEAFNFRNTDDINHYEKLLQEGFDVISSELEKLDQIFVDTK 241
gi 40063125 160 NQRLGEVLITPSSKGVLEGLEGIAAIDDVNITRADIERHWSQLGFEQPEDIDHYERLLREGFAVIADRLSKLGQLFVDTK 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39932005 242 FEFGYVADQQGQQKLIYMDEVGTPDSSRIWDAQQYQQGKIVENSKEGFRQFLLNYFPDPDILLNKDRMPEREALARDNAL 321
gi 46913091 242 FEFGYVTDASGKEKLIYMDEVGTPDSSRIWDAAAYRDGKIVENSKEDFRQLLLNHFPDPDILLNKDRMEERSALARDNAL 321
gi 40063125 240 FEFGYATGVEGTRELIYMDEVGTPDSSRIWNAGAYAQGTVLENSKEGFRQALMNWVPDRNLLLDKHRMVERAAFAGSTLL 319
                       330       340       350       360
                ....*....|....*....|....*....|....*....|....*
gi 39932005 322 PLEALMDISRTYLGIAEKITGQPIHLSHQPKQEIIAILDKEYGLI 366
gi 46913091 322 PEEVLMQVSKIYTDIAEKITGKKIVLSKNPKAEITAILRDQYGLV 366
gi 40063125 320 PQSMLLDVSETYLGIAAQIIGSSITVPENPRAEIKELLSVELGLV 364
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap