Conserved Protein Domain Family
TraQ

?
TIGR02741: TraQ 
type-F conjugative transfer system pilin chaperone TraQ
This protein makes a specific interaction with the pilin (TraA) protein to aid its transfer through the inner membrane during the process of F-type conjugative pilus assembly.
Statistics
?
PSSM-Id: 131788
View PSSM: TIGR02741
Aligned: 3 rows
Threshold Bit Score: 131.549
Threshold Setting Gi: 52538083
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52538083   31 MRKFRFRLPEFDVPGLWVLSLGIWFHIVSRLVRREPEMAILLAQIIGVSMVLWGGYRIINRWIdaAREAEKARDAGGCRH 110
gi 68166346    1 MRKYKLSLPLPDITGSMGFLPGRLVHIVGRLVYRKPWMAFFLAELIAVILVLSGAYRVLDAWI--ARVSREERALLEARQ 78
gi 446546762   2 ISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWI--ARVSREEREALEARQ 79

                 ..
gi 52538083  111 EP 112
gi 68166346   79 TA 80
gi 446546762  80 QA 81
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap