Conserved Protein Domain Family
GerC3_HepT

?
TIGR02748: GerC3_HepT 
heptaprenyl diphosphate synthase component II
Members of this family are component II of the heterodimeric heptaprenyl diphosphate synthase. The trusted cutoff was set such that all members identified are encoded near to a recognizable gene for component I (in pfam07307). This enzyme acts in menaquinone-7 isoprenoid side chain biosynthesis. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 131795
View PSSM: TIGR02748
Aligned: 7 rows
Threshold Bit Score: 558.18
Threshold Setting Gi: 46881433
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10174270   2 KLADIYAHFQEDIFTIERELEEAVQ-ARHDILRKASVHLLKAGGKRIRPVFVLLAGKFG-TYDVNVLKHIAVPLELIHMA 79
gi 56909897   2 KLADIYKAFQGDIEFIEAELERTLS-AKHPVLKEASTGLLKAGGKRIRPVLVLLAGKFG-DYQLDRLKHIAVTLELIHMG 79
gi 2829443    2 KLKAMYSFLSDDLAAVEEELERAVQ-SEYGPLGEAALHLLQAGGKRIRPVFVLLAARFG-QYDLERMKHVAVALELIHMA 79
gi 399776    30 KFKMAYSFLNDDIDVIERELEQTVR-SDYPLLSEAGLHLLQAGGKRIRPVFVLLSGMFG-DYDINKIKYVAVTLEMIHMA 107
gi 49332574   5 KLQLMYSFLRSDINVIEKELKKTVA-SEQPLVEEAALQLIEAGGKRIRPVFVLLAGKFG-DYKLDAIKHVAVALELIHMA 82
gi 22777472   2 KLPKIYGFLKKDMESIESALQDSIQ-ANHPVLRDASTELLHAGGKRIRPVFVLLSSQLG-NYDLSKIKKVAVTLELIHMA 79
gi 46881433   2 KLNFLYANMQKDIDSVEKELKKALSgAAAETTSDAALHLLEAGGKRIRPMFVCLSARLApNADFDAVKNASVAIELIHMA 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10174270  80 SLVHDDVIDDADLRRGKKTIKSQWDNRIAMYTGDYMFAKAVQTATYFDDPNIHQIISNAINEMCLGEVEQIRDQYNPNQH 159
gi 56909897  80 SLVHDDVIDNAPLRRGRETVMSRWDNRVAMYTGDYIFGHAIETTKAFSDKRVHTIISDVMNQICRGEIEQIRDQYNWDQG 159
gi 2829443   80 SLVHDDVIDDADLRRGRPTIKAKWSNRFAMYTGDYLFARSLERMAELGNPRAHQVLAKTIVEVCRGEIEQIKDKYRFDQP 159
gi 399776   108 SLVHDDVIDDAELRRGKPTIKAKWDNRIAMYTGDYMLAGSLEMMTRINEPKAHRILSQTIVEVCLGEIEQIKDKYNMEQN 187
gi 49332574  83 SLVHDDVIDAAFLRRGSATVNAKWGDRIAMYTGDYLFAKSLECITNIEIPEAHQALSHTILEVCKGEIEQIKDKYNYDQN 162
gi 22777472  80 TLVHDDVIDEAELRRGKPTTASIYGNRVAMYTGDYILARALEEITEIPDPRVHQLLSKTLVEVSIGEIEQIEYKFNWEQN 159
gi 46881433  82 SIVHDDVVDNADLRRGRETIKSKWGNHIAMYTGDFLFAKSLEYMTEIKDVAAHKMLSHVTVELSTGEIEQLKDKYNFDQS 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10174270 160 LRIYFRRIKRKTALLIAVSCQLGALAAKADPAIVQKLYYFGYYVGMSFQITDDVLDFVGTEEQLGKPAGSDLLQGNVTLP 239
gi 56909897 160 LRIYLRRIKRKTALLIAVSCQLGAIVSGATDELQKNLYYFAYFLGMSYQIMDDILDFVGTNEQLGKPAGGDLRQGNVTLP 239
gi 2829443  160 LRTYLRRIRRKTALLIAASCQLGALAAGAPEPIVKRLYWFGHYVGMSFQITDDILDFTGTEEQLGKPAGSDLLQGNVTLP 239
gi 399776   188 LRTYLRRIKRKTALLIAVSCQLGAIASGADEKIHKALYWFGYYVGMSYQIIDDILDFTSTEEELGKPVGGDLLQGNVTLP 267
gi 49332574 163 LRTYLRRIKRKTALLIAASCQLGAIAAGANRDTVSRLFWYGYFVGMSYQIIDDILDFVSTEEKLGKPAGGDLLQGNITLP 242
gi 22777472 160 FRDYLRRIKRKTALLIASSCKLGAIVGGLNDYQTNKLYQYGYYIGMSYQIIDDILDFTSTSKELGKPAGNDLLQGNITLP 239
gi 46881433 162 VRNYLRRIKRKTALLIAASCGLGGVVSGQSEADYQKLYRFGYYVGMAFQITDDVLDFVGTEKELGKPAGEDLRQGNVTLP 241
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10174270 240 ALYALHHDMhAKRLIEQVLADRg-nNSVHMEEVIAAIVSSGGIDYALSISDLYLKKAMRMLDHLPDDEPKQFLQEIANYI 318
gi 56909897 240 ALYAIEHTPgFKQRLEKSLTKEs-sLEMDMEPLLNEVRTSGGIEYAQAMSDRYLHKANTLLMGFPDIDAKRHLIEVASYI 318
gi 2829443  240 VLYALSDER-VKAAIAAVGPET---DVAEMAAVISAIKRTDAIERSYALSDRYLDKALHLLDGLPMNEARGLLRDLALYI 315
gi 399776   268 VLYALKNPA-LKNQLKLINSET---TQEQLEPIIEEIKKTDAIEASMAVSEMYLQKAFQKLNTLPRGRARSSLAAIAKYI 343
gi 49332574 243 ALYAMEDPI-LCKKIRSVHENT---TADEMKEIIEAVKNSAAIDKAFAFSERYLHKALEMIKPLPRGQAKYALQNVAKYI 318
gi 22777472 240 VLYAMEDKT-FKQSLFNVFSKDghvTTNEMKTLIQHLKRTDAIKRSYAVSDMYLSKALTALDEIPASRAKKTLQDIATYI 318
gi 46881433 242 VFFAMEDPF-LKKRISQVTEET---PAEEIAVLVEEVKKA-GAKQAEDVATVYLKKAVEILDSLPQVPELKPLKQIVRVL 316

                ....*
gi 10174270 319 GRRKF 323
gi 56909897 319 GRRKY 323
gi 2829443  316 GKRDY 320
gi 399776   344 GKRKF 348
gi 49332574 319 GKRKF 323
gi 22777472 319 GKRRS 323
gi 46881433 317 DKRNY 321
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap