Conserved Protein Domain Family
prenyl_cyano

?
TIGR02749: prenyl_cyano 
solanesyl diphosphate synthase
Members of this family all are from cyanobacteria or plastid-containing eukaryotes. A member from Arabidopsis (where both plastoquinone and ubiquinone contain the C(45) prenyl moiety) was characterized by heterologous expression as a solanesyl diphosphate synthase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]
Statistics
?
PSSM-Id: 131796
View PSSM: TIGR02749
Aligned: 6 rows
Threshold Bit Score: 541.262
Threshold Setting Gi: 72001745
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5734760   55 ISLETLFEVVADDLQRLNDNLLSIVGAENPVLISAAEQIFSAGGKRMRPGLVFLVSRATAELAglkELTVEHRRLGEIIE 134
gi 72001745   2 TTATEILQPVELDLEALLLDLRSLIGAGHPILQAAAEHLFSAGGKRLRPGIVLLISRALTSEK---ELPLKHRKLAQITE 78
gi 15214189   2 ISTTSLFAPVDQDLRLLTDNLKRLVGARHPILGAAAEHLFEAGGKRVRPAIVLLVSRATLLDQ---ELTARHRRLAEITE 78
gi 399307     2 ASITNILAPVENELDLLTKNLKKLVGSGHPILSAASEHLFSASGKRPRPAIVLLISKATMENE---IITSRHRRLAEITE 78
gi 35211315   4 VSAANWSALVEDDLSQMTRNLKNLLGTKHPVLYAAAEHLFNAGGKRIRPALVLLVSRATAAYG---EPTERHRRLAEITE 80
gi 1709766    2 ATSSSLFHPIEKELYSVEHNLKSVAGTRHPILYAAAKHLFEAGGKRLRPAIVLLVAKSTSEQQ---EIKPGQRRLAEITE 78
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5734760  135 MIHTASLIHDDVLDESDMRRGRETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIKDFASGEIKQASSLF 214
gi 72001745  79 MIHTASLVHDDVVDEADTRRGVETVHSRFDPRIAVLAGDFLFAQASWHLANLENLEVVKLLSRVIMDLAEGEIKQGLNRF 158
gi 15214189  79 MIHTASLVHDDVVDEADLRRNVPTVNSLFDNRVAVLAGDFLFAQSSWYLANLDNLEVVKLLSEVIRDFAEGEILQSINRF 158
gi 399307    79 IIHTASLVHDDILDESDVRRGIPTVHSDFGTKIAILAGDFLFAQSSWYLANLESLEVVKLISKVITDFAEGEIRRGLNQF 158
gi 35211315  81 MIHTASLVHDDVIDTSAVRRGIDTVNSRFGNRVAVLAGDYLFGMASAYLARLGSLEVVELLGIVISHFGEGELLQSTLQF 160
gi 1709766   79 IIHTASLVHDDVIDECSTRRGEKTVHKLFNTKIAVLAGDFLFAQSSWYLANIGNLEVVKVITKVITDFAEGEIRQGLVHF 158
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5734760  215 DCDVKLDDYMLKSYYKTASLVAASTKGAAIFSKVESKVAEQMYQFGKNLGLSFQVVDDILDFTQSTEQLGKPAANDLAKG 294
gi 72001745 159 DSSQSFESYLEKSYCKTASLIANSSKAIGVLSNVDQESLNSLYFFGRQLGLAFQVVDDILDFTGNDEQLGKPAASDLQSG 238
gi 15214189 159 DTDTDLETYLEKSYFKTASLIANSAKAAGVLSDAPRDVCDHLYEYGKHLGLAFQIVDDILDFTSPTEVLGKPAGSDLISG 238
gi 399307   159 KVDLTLEEYLEKSFYKTASLLAASSKAAALLSHVDLTVANDLYNYGRHLGLAFQIVDDILDFTSSTEELGKPSCSDLKKG 238
gi 35211315 161 DSDLTFEQYIDKSFYKTASLMAGTSRAAAVLSESPAAVCEALYEYGRHLGIAFQVIDDLLDFTGSTAKLGKPAGSDLRDG 240
gi 1709766  159 DPSISIDDYIEKSFYKTASLVAASCRGAAMLNDLNSQMHNDLYLYGKHMGLAFQIMDDVLDIAGSTKSLGKPSGADFMNG 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 5734760  295 NITAPVIFALENEPRLREIIESEFCEPGSLEEAIEIVRNRGGIKKAQELAKEKAELALKNLNCLPRSGFRSALEDMVMFN 374
gi 72001745 239 YLTAPVFYALEENPSLSELINGKFSQKDDLDQALSLVRDSSAIKKSRELAEQFASESKDSISWLPDSPSKKALLELPEFV 318
gi 15214189 239 NITAPALFAMEKYPLLGKLIEREFAQAGDLEQALELVEQGDGIRRSRELAANQAQLARQHLSVLEMSAPRESLLELVDYV 318
gi 399307   239 NLTAPVLFALEQNSELIPLIQRQFSEPKDFEYTLQIVEETKAIEKTRELAMEHAQVAIQCLENLPPSSSKEALKLITKYV 318
gi 35211315 241 NLTAPVLYALEESPHLSGLIERQFEQKGDLEKALSLIHASRALERTRELAETHARRAVTSLDTLSPSPAREALKDLVGHT 320
gi 1709766  239 NLTAPILFALTQEGKLDQLIQREFSDERDISLALFLIKKSGGITKAKDLAKEQVQAALCCLQFLPKSAPVSSLKELTHFI 318

                ....*
gi 5734760  375 LERID 379
gi 72001745 319 ISRLY 323
gi 15214189 319 LGRLH 323
gi 399307   319 LERLY 323
gi 35211315 321 VSRLY 325
gi 1709766  319 ITRLS 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap