Conserved Protein Domain Family
PEPCase_arch

?
TIGR02751: PEPCase_arch 
phosphoenolpyruvate carboxylase, archaeal type
This family is the archaeal-type phosphoenolpyruvate carboxylase, although not every host species is archaeal. These sequences bear little resemblance to the bacterial/eukaryotic type. The members from Sulfolobus solfataricus and Methanothermobacter thermautotrophicus were verified experimentally, while the activity is known to be present in a number of other archaea. [Energy metabolism, Other]
Statistics
?
PSSM-Id: 131798
View PSSM: TIGR02751
Aligned: 10 rows
Threshold Bit Score: 613.254
Threshold Setting Gi: 19886496
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20907896   7 YPKVMCTQHPDS------ASK---YISTQEEPGEAIEAAVVFGCDEYMPDYEGKATPYHQNVQIVSRFIEETD-LIPGKD 76
gi 13815559   4 IPRTMSTQHPDNakvpewAKSe--VIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTHVVRKLLSNYPDYFReHILGKD 81
gi 48430684   6 IPKTMSTQHPDNakmpawASEk-sMIRNDDEVEEAYQCYT-IGIKEVMWDAEGKDVDTHVLRKLISKNHEFFEkNVLGSD 83
gi 68139797   2 IPKTMSTQHPDNalmpewSSNk-nIITNEDEIEEAYIAYKKLGIQEVMWDAEGKDVDTHVIRKLFAKDRIFFEnSKIGQD 80
gi 78705288  11 IPRTMSTQHPDNvhtpffTENi--ELTGEDEVKEAYYVYSHLGCTEQMWDCEGKEVDNYVVKKLLSRYGDYFKeHHLGRD 88
gi 10581673   4 VPRLMSTQHPDNatlpffTAGd--VIEGEDEIQEAYYVYSHLGCDEQMWDFEGKEGDEYAVKKLLSRYDEFFAdHQLGTD 81
gi 2649088    2 VPRVMSTQHPDNaripffAASe--VLNGEDEVREAYYVFSHFKCDEQMWDFEGKEADAHIVRKLLSSYYDFFSsRPLGKD 79
gi 3256401    8 IPRIMSTQHPDNysipffASSp--ILGGEDEITEAFYAFSVLGADEQMWDFEGKEVDEFVVKKLLERYPTFFKeNILGED 85
gi 23023829   6 IPSIMGTQHPDNanapfwESSqqpFISAYRETGEAFENFNELNVDEYMWDWEGKHADAAVIDRLFSTEYDYFKdHQIGRD 85
gi 19886496   9 IARTLATQHPD-------ATK---FVRVQEEPEEAVECLVELGAEEYMVDFEGKLTPYLQPIQVLMELYDAG--VRVGEE 76
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20907896  77 IFITPRAPSAAQENR-FRQLMVMMSIAEANHGAL-EYSDVQ------AINEFVHPMTGTVGEILDAQQHMVDVG------ 142
gi 13815559  82 LFLTYRLPNPKVEGAdRKVFAETMESIPITYDLAeKFYGNGit---iPVFEVILPMTTSSLEIISVARYYEKAVanedel 158
gi 48430684  84 IFLTYRVPNPAIEGTeRKVLTETLESIPVNYDVFnTVYKRDi----pPIFEVILPFTTSSKDLLNIAKYYEKAVaardei 159
gi 68139797  81 IFLTYRVPNPLIEGAeRKILNETLNSIPLNYDVSnRIFNNGi----aPIFEVILPFTTDYRSMLNVVKFYEKCVvgaqsi 156
gi 78705288  89 LFLTLRVPNPEIERTeAKILLETLGSIPRSYDVAhHFYNDTy----aPIFEIILPMTTSFASIDNIYQYYCDFVigqqyk 164
gi 10581673  82 VRLTVRGPNPDVEGSeAKILLEILESIPRSFDAArRFAGEYglettaPIFEVIVPMVTDADQLNAVHEYYERFVtgkade 161
gi 2649088   80 FRLTMRVPNPEIEKGeAKLLAETLEMIPRSYDYVrSLGIEHp-----PIFEVILPMTRSAEEVMKVHAFYRDFVagkgrf 154
gi 3256401   86 LRLTPRVPNPSVEKAeAKLLLETLQGITRAADYArVFYLDNi----aPIFEVILPMTTSLAEMLRVHELYRKIVsl--sg 159
gi 23023829  86 KFLTFRFPNIWEEKG-YNLMQAMTAFL-SSEDFAhDLGFSR------PLFEAILPMAQRADQILKMQVLFEKLAn----- 152
gi 19886496  77 RFVIVRVPSATKENV-LRQVQALLGVMEANSELLkEDPDAR------GIFEVVHPMTSSPEELVETVDRISYAR------ 143
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20907896 143 ELAKK-----EFGVAMEVP--RIIPLIEDAPALLHAKELAENTLLSWEkrfgaaPEKFRVFLGKSDSALSFGHVASTLSC 215
gi 13815559 159 ELYDGvk-vkDLVGEIYPKviEVIPLVEDRDSLQNINNIVEGYYKVIK------PKYMRVFLARSDPAMNYGMITAVLSV 231
gi 48430684 160 ELYDNvm-vkNILGETKPKkiNIIPLIEDKDSMFNIDGIVKNFARAVS------AKKMRVFIARSDPAMNYGMIPAVLMS 232
gi 68139797 157 NLYDNvy-srDVTGEVLPGkiNLIPLIEDKDSIFNIEHIVKEYHRVIS------PEYMRIFIARSDPAMNYGMIPATLLA 229
gi 78705288 165 RLGGRdltiaEWIGPFHPDkiRVIPLFEDKDGMLAADTILRRYFQDKD------LDYQRVFLARSDPAVNYGQIGAVLLN 238
gi 10581673 162 AVWDGrt-veEWVGEFDPAsiTVIPLIEEREAMLAADDIVREYATAHD------QDAVRVFLARSDPALNYGCLAADLIN 234
gi 2649088  155 ELLGEkv--sDWLGDFLPEeiKVIPLFEDRDSLMRAAEISERYAEWAE------LDELRVFLARSDPAMNYGFVAATIYV 226
gi 3256401  160 EVIYDvt-vkEWIGEFYPKeiNVIPLFETKVALLKSGRIIREYIGRKR------PEYLRVFFARSDPAMNYGLLSAVTYV 232
gi 23023829 153 FKSAEf---tR--SDKNTPyiEMIPLFEDFETQLHAPEILKEYLNLHEehfgfrPKYMRVFLAGSDSALTAGFMSSITGN 227
gi 19886496 144 RFASR-----ELDVPLKAGnlRIIPLIEEVPELLDIRNILTGYVEGMReig-mdVSYLRVFIGRSDPALSYGHLPAVLAC 217
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20907896 216 KYAISGISELDLELDTSTGIIFGAGTLPFRGHLSLKNAENFFREYRGIGTITLQSAVRYSHDKGEAEALVRLAEERLPES 295
gi 13815559 232 KIALSELYKLSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSAISSINNSRISP 311
gi 48430684 233 KYAASRLCKMNDDIEN--YPIVGVGSSTFRGRFSPENIEKSLYEYSNYYTFTLQSAFKYDYPQDSVKNSINIINRH-ERS 309
gi 68139797 230 KYAASKMGQISDDTGMSVYPIIGAGSSPFRGNLGPANIKRALSEYDQYYTFSIQSAFRYDYNDQEVKDSIKLINKHTPQK 309
gi 78705288 239 KIALWRLHLLSEDTGIPVYPIIGAGSAPFRGNLRPDTVRRVTDEYAGAYTFTIQSAFKYDTNLEEAVSAIRYLEEREI-T 317
gi 10581673 235 KVALQRLYEMSEATGVDVHPILGAGSAPFRGNLTPERAAATADAYSEVETFTVQSAFKYDYPVETVRDGVATLRDADLGA 314
gi 2649088  227 KKALYDLSQL----GISTYPILGVGSCPFRGGFSPKNLS-VLDEFPSVYTFTVQSAFKYDYEFGDVRRAIKRAKEAAR-- 299
gi 3256401  233 KKALEQVGEVEEETSTPIYPIIGVGSPPFRGGMRPENVKKVLKEYPSVQTYTIQSSFKYDHPTKDVVKAVEIVKSKKR-- 310
gi 23023829 228 KLAIARLHEFAEEENIEIFPISGTGSAIFRGGLSPHRIDRYVTEFPGVRTATVQSAFRYDFPIEEVQKGIAELKEKLPVA 307
gi 19886496 218 KLAIFEVYELSDELGVPMAPILGGGCLPFRGHIRPGMEEEFVEEYAGTATYTVQSGFRYDHDREKAVASIRRINELAAND 297
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20907896 296 PEIYSGEEKE-EIVNLIGIFGARYNRIIREMSCTINQLAGLLPQQRDRLMHKGTGGYSRNVPdisglvclcrkd------ 368
gi 13815559 312 ARILEKYEED-VLRKITILYTERYQPIIESLANAINDVSVLLPRRRARKLHIGLFGYSRSAG------------------ 372
gi 48430684 310 FDYLEDYEEE-IIKNAVNKYVINYQKIIEKLAPAINNITMYLPKRRSRKLHIGLFGYSRSTG------------------ 370
gi 68139797 310 AEFIDIETEK-IIKGIVGTYSERFQKIIEDIAQPINDITFYLPKRRERKLHIGLFGYSRSTG------------------ 370
gi 78705288 318 PAREIDDTY---AISLIERYAAGYQKQIRSLAPLINRVAAYIPSRRKRKLHVGLFGYSRNMG------------------ 376
gi 10581673 315 PPFPIDEAR---ALAVIDRTADAYADQVDAIAGTVNRLSSYVPDRRARKLHVGLFGYAREVG------------------ 373
gi 2649088  300 RKSDYVDEE---HLQVAEKLKDGYRRRIAKIAEIVNRISSRIPRRRMRKLHVGLFGYSRGE------------------- 357
gi 3256401  311 --EAPDPLD---IPEFIQLYEIEYQKQLKILAPYIRNIVTRIPDRRKRKLHIGLFGYSRNVG------------------ 367
gi 23023829 308 EPLKISLDDQkILTEIAEESAKFYSNTLDNLVPSMQAIFKAFPKRRDRRQHVGVLGYSRSVD------------------ 369
gi 19886496 298 PLQLSGDDIE-YLVLATAIFMKHYLSVFFRCIGTLNIVADMIPNTRDRLARKGPVGYARDIPepdrvgaqckdlgdvgre 376
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 20907896 369 vgkelsasmpaeDLNLPRAIKFTGALYSIGLPPEFIGTGTaLEEAREKLGEeacerLLKKYFPSLASDLSFASGYLDLNV 448
gi 13815559 373 ------------KVSLPRAISFVGSLYSIGIPPELIGISS-LSNLDEKEWD-----IFKQNYVNFKHDLQTAARFLNWES 434
gi 48430684 371 ------------NVTLPRAISFVGAMYSMGLPPEIIGISS-LLNMKDDELD-----IIEKTYINLRSDIMESSSYLNYEV 432
gi 68139797 371 ------------KASLPRAISFVGALYSIGVPPEILGIAS-LSSLPESSQV-----LLKKLYRYMEQDIKASAQYFNYES 432
gi 78705288 377 ------------GVSLPRAITVTAALYSIGIPPEVLGLSA-LT---ENDRE-----FVLENYRYVTEDLSDACRYLNPDS 435
gi 10581673 374 ------------ENALPRAIGYTASLYAVGCPPTLLGAHA-LT---DDDAA-----FVREAFPAYFDHLADAARYFNPRC 432
gi 2649088  358 ------------EIKLPRAITFCASLYSIGLPSEIIGIAE-MS---DKDYE-----AVCEVFKNFDGMMESAMSLFNPES 416
gi 3256401  368 ------------GLSLPRVIKFTASLYSIGLPPELLGLNE-LS---DNQLD-----SISEYYKNLYDDLEFAMRFFSFKV 426
gi 23023829 370 ------------GIELPRAINFTGSFYSVGVPPEFIGFGRaLKHLDADHLS-----VFVRSYPSMSKDFNELARFVNMDA 432
gi 19886496 377 lyrelrrmrvekLPELPRAIKFTGACYTVGMPPELIGTGRgLAEIEERLGEdaldaVISRLYPMLREDLQFAVEYTFLET 456
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 20907896 449 ASRFLPEACLKEIRKDIEVLRDTFSLKVQPEpSYrILLEMMQPDLLQAGTKGNCMDEEVSQLVCSTLTKMGKIRKALG 526
gi 13815559 435 FKLIKDIWKISEDTIAKIKEDIDYAESVIGI-KLgGIDYDSRKHILMSSLFLLSFKEKILQESKKYLYEMALIRRSLG 511
gi 48430684 433 FDALKDVYKIDQETINMIKADVKYIENNYGI-KS-DLGYERERHNYLSSLMNLAFKNHDFENTRKYILDMALIRKFIG 508
gi 68139797 433 LDYLKEIWKVSDKTLDMIREDIKYVEDNIGI-PT-ETSYNVQKHNLYTKLLLMAFKNRKFEEVKSYIYELSLLRKFIG 508
gi 78705288 436 S-------FLPDEIKK---ILPDWIEIDPH-----------SEHRVLSGQIEKAVTACQIDSVQDMIIRAGAIRKFLG 492
gi 10581673 433 T----DVLDLDDDTLA---AAVERVDVTPN-----------SEHRAATDDAIDALQRGDDDALRSAIRRGARERQFLG 492
gi 2649088  417 L----KIVDLSMDFER----AKELFGYEPD-----------ERHLEKTNEIIKQIDG----DIKNLVVEAGILRGFLG 471
gi 3256401  427 A----ERVGLRELSEK--VKEFKPDID--------------DEYVREAELVFRGQGD---------VMKLAQIRGFLG 475
gi 23023829 433 LQILKTQNSAWAEVEEDILIMQRIFKFEIG------PQTREEQQHAEIALQVVQFKDGAPVAITALINRMAQLRHFLG 504
gi 19886496 457 AGSVLPSSGVAMVNTDLEYCVEYLDLEPPSDfEYqNLVHTLEPYLRYVVSEG--GVEEVNPFVRDLLLEMGRMRGSLG 532
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap