Conserved Protein Domain Family
sodN

?
TIGR02753: sodN 
superoxide dismutase, Ni
This superoxide dismutase uses nickel, rather than iron, manganese, copper, or zinc. Its gene is always accompanied by a gene for a required protease.
Statistics
?
PSSM-Id: 131800
View PSSM: TIGR02753
Aligned: 4 rows
Threshold Bit Score: 205.19
Threshold Setting Gi: 12644360
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 33640218   1 MLTKLVNSLLNKKSTLEVHAHCDGPCGVYDPASTRVAAEAVLAMTKKLIALNPPSSTDsadwAAYSNTFSRFVAVKEEQA 80
gi 33238346   1 MLRLAISSLLKRLPAQKALAHCDGPCGVYDPASARISAEAVLSMTKKLLALTPPEGKDssewATYNNTFSRFVAVKEEQA 80
gi 12644360   1 MLSRLFA------PKVTVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDP------------HFQTRATVIKEQRA 62
gi 71145983   1 MLYDIIAKFDKKLHFPVVMAHCDIPCKIYDPIGAQISVLTIIRMVDLLNELKAKSSLT----LDEQAEFLRLVNQKENHG 76
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 33640218  81 KETKKEILILWTDYFKPVHLETYPDLHETIWKAAKLCSACKVNIDLAQAEELMSYVEKIHNIFWESKGR 149
gi 33238346  81 QETKKELLILWTDYFKPEHLASFPDLHDTFWKAAKLCSACKVNIDQSKTEELMAAVEKVHHMFWKSKGR 149
gi 12644360  63 ELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQIDKIFWETKKA 131
gi 71145983  77 IKVKEEISVIWGDYIKAPQLTQFPELHELVHNIMLASSQAKQHISKEAAQILLQQVNRFAEIFWATKKV 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap