Conserved Protein Domain Family
TraX_Ftype

?
TIGR02755: TraX_Ftype 
type-F conjugative transfer system pilin acetylase TraX
TraX is responsible for the acetylation of the F-pilin TraA during conjugative plasmid transfer. The purpose of this acetylation is unclear, but the reported transcriptional regulation of TraX may indicate that it is involved in the process of pilu extension/retraction.
Statistics
?
PSSM-Id: 131802
View PSSM: TIGR02755
Aligned: 3 rows
Threshold Bit Score: 275.226
Threshold Setting Gi: 157149406
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45359317   23 LLAWSPGQRDLIKTVALLLMVADHINRILHLNQEWLFLAGRGAFPLFALVWGLNLSRHTHIRQSAINRLWGWAVIAQSGY 102
gi 446127855  25 FLVWSPGQRDIIKTVALVLMVLDHINLIFLLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAY 104
gi 500818116  24 VLNFSALQRDVIRMVAFVAMVGDHIATAFQLDMPLLNMGGRCAFPLFALVCGCNMAGK-TLRQHSLNRLWLMALLAQPGY 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 45359317  103 FLA----GFPWYEGNILFAFAVTAQALKWCEQRCLFHSAAALLLLTAWIPLSGTSYGVAGVLVLVICYRLYRITDTEEHL 178
gi 446127855 105 YLA----GFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAGLLMLAVSHRLYRAEDRAERL 180
gi 500818116 103 WLAfrdvGLAWWQLNILFTFAVVMQVALFLQSATARNGVAAFTVLMGYTPFSSASYGIPGLLMLAGALLVWQVRGT-LRP 181
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 45359317  179 ALAACLVVAVPALNLVTSDAAAVAGLLVTGLTV----WLVSLTGKSRPRFWPADFFPVFYTCHLAALGVLAM 246
gi 446127855 181 ALVACLLAVIPALNLATSDAAAVAGLVMTVLTV----GLVSCTGKSLPRFWPGDFFPTFYGCHLAVLGILVL 248
gi 500818116 182 ALFAVWLLLVALLNARHGDVMMFSGVILTLTVLfcvhGLVPASGR---RLQAGRWFAPAYAIHLFFIGFLVR 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap