1U3C


Conserved Protein Domain Family
crypt_chrom_pln

?
TIGR02766: crypt_chrom_pln 
Click on image for an interactive view with Cn3D
cryptochrome, plant family
At least five major families of cryptochomes and photolyases share FAD cofactor binding, sequence homology, and the ability to react to short wavelengths of visible light. Photolysases are responsible for light-dependent DNA repair by removal of two types of uv-induced DNA dimerizations. Cryptochromes have other functions, often regulatory and often largely unknown, which may include circadian clock entrainment and control of development. Members of this subfamily are known so far only in plants; they may show some photolyase activity in vitro but appear mostly to be regulatory proteins that respond to blue light.
Statistics
?
PSSM-Id: 131813
View PSSM: TIGR02766
Aligned: 5 rows
Threshold Bit Score: 893.063
Threshold Setting Gi: 28201254
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U3C_A        15 IVWFRRDLRVEDNPALAAAVRAG-PVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGT-CLITKRSTDSVAS 92
gi 28201254   21 VVWFRRDLRVEDNPALAAAARAGgEVVPAYVWAPEEDGPYYPGRVSRWWLSQSLKHLDASLRRLGAgKLVTRRSADAVVA 100
gi 332278156  15 IVWFRRDLRVEDNPALAAAVRAG-PVIALFVWAPEEEGHYHPGRVSRWWLKNSLAQLDSSLRSLGT-CLITKRSTDSVAS 92
gi 3913379     8 IVWFRRDLRIEDNPALAAAAHEG-SVFPVFIWCPEEEGQFYPGRASRWWMKQSLAHLSQSLKALGS-DLTLIKTHNTISA 85
gi 51964176    8 VVWFRRDLRIDDNPALASAARDG-AVLPVFIWCPADEGQFYPGRCSRWWLKQSLPHLSQSLESLGC-PLVLIRAESTLEA 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U3C_A        93 LLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVRSFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDP 172
gi 28201254  101 LLQLVRDTGATRLFFNHLYDPISLVRDHRLKEMMAAEGIIVQSFNADLLYEPWEVVDDEGQSFTMFAPFWNRCLSMPYDP 180
gi 332278156  93 LLDVVKSTGASQIFFNHLYDPLSLVRDHRAKDVLTAQGIAVRSFNADLLYEPWEVTDELGRPFSMFAAFWERCLSMPYDP 172
gi 3913379    86 ILDCIRVTGATKVVFNHLYDPVSLVRDHTVKEKLVERGISVQSYNGDLLYEPWEIYCEKGKPFTSFNSYWKKCLDMSIES 165
gi 51964176   86 LLRCIDSVGATRLVYNHLYDPVSLVRDDKIKKELSALGISIQSFNGDLLYEPWEIYDDSGLAFTTFNMYWEKCMELPIDA 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U3C_A       173 eSPLLPPKKII-----SGDVSKCVADPLVFED-DSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRRKADSAT 246
gi 28201254  181 aAPLLPPKRIN-----SGDLSMCPSDDLIFED-DSERGSNALLARAWSPGWQNADKALTAFLNGPLIHYSVNRKKADSAS 254
gi 332278156 173 eSPLLPPKKII-----SGDVSKCVADPLVFED-DSEKGSNALLARAWSPGWSNGDKALTTFINGPLLEYSKNRRKADSAT 246
gi 3913379   166 -VMLPPPWRLMpitaaAEAIWACSIEELGLEN-EAEKPSNALLTRAWSPGWSNADKLLNEFIEKQLIDYAKNSKKVVGNS 243
gi 51964176  166 -SPSLAPWKLVpv-pgLESVRSCSVDDLGLESsKDEESSNALLMRAWSPGWRNAEKMLEEFVSHGLLEYSKHGMKVEGAT 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U3C_A       247 TSFLSPHLHFGEVSVRKVFHLVRIKQVAWANEGNEAGEESVNLFLKSIGLREYSRYISFNHPYSHERPLLGHLKFFPWAV 326
gi 28201254  255 TSLLSPYLHFGELSVRKVFHLVRMKQLVWSNEGNRAAEESCTLFLRSIGLREYSRYLSFNHPCSHEKPLLAHLRFFPWVI 334
gi 332278156 247 TSFLSPHLHFGEVSVRKVFHLVRIKQVAWANEGNEAGEESVNLFLKSIGLREYSRYISFNHPYSHERPLLGHLKFFPWAV 326
gi 3913379   244 TSLLSPYLHFGEISVRHVFQCARMKQIIWARDKNSEGEESADLFLRGIGLREYSRYICFNFPFTHEQSLLSHLRFFPWDA 323
gi 51964176  244 TSLLSPYLHFGEVSVRKVYQLVRMQQIKWENEGTSEAEESIHFFMRSIGLREYSRYLCFNFPFTHEKSLLGNLKHYPWKV 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U3C_A       327 DENYFKAWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYITGT 406
gi 28201254  335 NECYFKIWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYISGS 414
gi 332278156 327 DENYFKAWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSSFFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYITGT 406
gi 3913379   324 DVDKFKAWRQGRTGYPLVDAGMRELWATGWMHNRIRVIVSSFAVKFLLLPWKWGMKYFWDTLLDADLECDILGWQYISGS 403
gi 51964176  324 DEERFKSWRQGMTGYPLVDAGMRELWATGWTHNRIRVIISSFAVKFLLIPWTWGMKYFWDVLLDADLESDILGWQYISGS 403
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1U3C_A       407 LPDSREFDRIDNPQFEGYKFDPNGEYVRRWLPELSRLPTDWIHHPWNAPESVLQAAGIELGSNYPLPIVGLDEAKARLHE 486
gi 28201254  415 LPDGRELDRIDNPQLEGYKFDPHGEYVRRWLPELARLPTEWIHHPWDAPASVLQAAGVELGSNYPLPIVGLDAANARLQE 494
gi 332278156 407 LPDSREFDRIDNPQFEGYKFDPNGEYVRRWLPELSRLPTDWIHHPWNAPESVLQAAGIELGSNYPLPIVGLDEAKARLHE 486
gi 3913379   404 IPDGHELDRLDNPALQGAKYDPEGEYIRQWLPELARLPTEWIHHPWDAPLTVLKASGVELGTNYAKPIVDIDTARELLAK 483
gi 51964176  404 LPDGHELSRLDNPEVQGQKYDPDGVYVRTWIPELARMPTEWIHHPWDAPSCILEVAGVELGFNYPKPIVDLHIARECLDD 483

                 ...
1U3C_A       487 ALS 489
gi 28201254  495 ALS 497
gi 332278156 487 ALS 489
gi 3913379   484 AIS 486
gi 51964176  484 SIS 486
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap