Conserved Protein Domain Family
TraG-Ti

?
TIGR02767: TraG-Ti 
Ti-type conjugative transfer system protein TraG
This protein is found in the Agrobacterium tumefaciens Ti plasmid tra region responsible for conjugative transfer of the entire plasmid among Agrobacterium strains. The protein is distantly related to the F-type conjugation system TraG protein. Both of these systems are examples of type IV secretion systems.
Statistics
?
PSSM-Id: 131814
View PSSM: TIGR02767
Aligned: 3 rows
Threshold Bit Score: 1051
Threshold Setting Gi: 2499037
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49240092   7 QLALILMPIALGALTIFLVPHLLSFMIN-DLKANHVYWYVRSEPLLVLMLVATVSLCYTLSQKLHLR-KAITLVSAVFFG 84
gi 2499037    5 RLLLLILPAIIMLAAMFATSGMEQRLAAfGTSPQAKLMLGRAGLALPYIAAVAIGIIGLFAANGSANiKAAGLSVLAGSG 84
gi 17743535  10 SLLLITIPIAVTGFSFYVAHWRWPELAA-GITGKTQYWFLRASPLPVLLFGPLAGLLAVWALPLHRR-RPVALASFLCFF 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49240092  85 ITALYFIGGEIKRLTPyVGQQGITWSYALKFMDPMVVFGVICGVVLLVIQVMIS-------SPPTSKVKRAKKGIFGDAS 157
gi 2499037   85 VVITIATLREVIRLNS-IASSVPAEQSVLAYADPVTMIGASIAFISGMFALRVAikgnaafATTAPKRIGGKRAVHGEAD 163
gi 17743535  88 LVAGFYGMREFGRLQPlVESGVLTWDQALSFVDMIAVVGAAMGFMAAAVAARIS-------SVVPEQVTRARRGTFGDAD 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49240092 158 WMNLKEAAKIFPANGQIVVGERYRVDQDGVCNIPFAPGNKTTWGKGGTAPLLTFNLDFGSTHMIFFAGSGGYKTTSTVVP 237
gi 2499037  164 WMKIQEAAKLFPERGGIIIGERYRVDRDSVAAMPFRADDRQSWGAGGKSPLLCFDGSFGSSHGIVFAGSGGFKTTSVTIP 243
gi 17743535 161 WLPMSAAARLFPDDGEIVIGERYRVDKELIHELPFDPNDPATWGRGGKAPLLTYAQDFDSTHMLFFAGSGGFKTTSNVVP 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49240092 238 TCLTYPGPIVCLDPSTEIAPMVRFARKKMGnRNVIVLDPNSLLTkNFNVLDWLLDDSvprTQREANIVGFSKLLLTDK-K 316
gi 2499037  244 TALKWGGGLVVLDPSSEVAPMVCEHRRQAG-RKVIVLDPTAGGV-GFNALDWIGRHG---NTKEEDIVAVATWIMTDNpR 318
gi 17743535 241 TALRYTGPLICLDPSTEVAPMVVDHRRDKLdREVVVLDPANPVM-GFNVLDGIEHS----LKKEEDIVGIAHMLLSESvR 315
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49240092 317 SENSSAEYFSTQAHNLLTALLAHVIFSDEYEDSERNLKTLRAILSQSETAVVNQLRMIQETTPSPFIREMVGIFTEMADQ 396
gi 2499037  319 TASARDDFFRASAMQLLTALIADVCLSGHTETEDQTLRRVRANLSEPEPKLRARLTKIYEGSESDFVKENVSVFVNMTPE 398
gi 17743535 316 FESSTGSYFQSQAHNLLTGLLAHVMLSPEYAGQ-RNLRSLRQIVSEPENSVLAMLRDVQEHSASAFIRETLGVFVNMTEQ 394
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49240092 397 TFSGVYTTASKDTQWLSLSNYADLVCGNDFSSSDIANGKTDVFLNLPASILNSYPAIGRVIIGAFLNAMVTADGKYKKRV 476
gi 2499037  399 TFSGVYANAVKETHWLSYPNYAGLVSGDSFSTDDLADGGTDIFIALDLKVLEAHPGLARVVIGSLLNAIYNRNGNVKGRT 478
gi 17743535 395 TFSGVYSTASKDTQWLSLDNYAALVCGNTFKSSEIAGGKKDVFINIPASILRSYPGIGRVIIGSLINAMIEADGAFTRRA 474
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49240092 477 LFVLDEVDLLGYMNILEEARDRGRKYGTSLMLFYQSSGQLVNHFG-EAGARSWFESCSFVSYAAIKDLQTAKDISERCGQ 555
gi 2499037  479 LFLLDEVARLGYLRILETARDAGRKYGIMLTMIFQSLGQMREAYGgRDATSKWFESASWISFAAINDPDTADYISKRCGD 558
gi 17743535 475 LFILDEVDLLGYMRVLEEARDRGRKYGVSMMLMYQSVGQLERHFG-KDGAVSWIDGCAFASYAAIKALDTARNVSAQCGE 553
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49240092 556 MTVEVTGTNKSRG----LSLGKSSYNVNYQQRALILPHEIIQeMRQDEQIILMQGQPPLRCGRAIYFRRKEMLAAANKNR 631
gi 2499037  559 TTVEVDQTNRSTG----MKGSSRSRSKQLSRRPLILPHEVLH-MRSDEQIVFTSGNPPLRCGRAIWFRRDDMKACVGENR 633
gi 17743535 554 MTVEVKGSSRNLGwgtkNSASRKSENINFQRRPLIMPHEITQsMRKDEQIIIVQGHSPIRCGRAIYFRRKDMDMHARPNR 633

                .
gi 49240092 632 F 632
gi 2499037  634 F 634
gi 17743535 634 F 634
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap