Conserved Protein Domain Family
nickel_nikD

?
TIGR02770: nickel_nikD 
nickel import ATP-binding protein NikD
This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131817
View PSSM: TIGR02770
Aligned: 7 rows
Threshold Bit Score: 330.485
Threshold Setting Gi: 34483091
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52004377  27 LVQDINFDLKRGQVLGLIGESGCGKTVTSMSILQTLDpKTTKVEGSIALRGRELNGLadkemrKIRGKDIAYIMQNPMNA 106
gi 34483091  22 LVQGVSFSLKENHCIGILGESGSGKSLTCKAILGLLG-EDFEVRGEVRFKGRNLLELpreereRIRQRELCMVIQSPMTA 100
gi 19917507  34 AVVDLNLVAKMGKITALVGESGSGKSTVALAVMGIQDkNAIISSGEIYLAGMDVLSIpkkdmrSYISNHAGIIFQDPIDS 113
gi 12331183  17 LVDNLSLGVQRGRILALVGASGSGKSMTCSAALGVLPpGVTASRGRVTIDGVPYAAN------ALRGRHVATIMQNPRGA 90
gi 34395957  18 LVHGVSLTLQRGRVLALVGGSGSGKSLTCAATLGILPaGVRQTAGEILADGKPVSPC------ALRGIKIATIMQNPRSA 91
gi 60390564  20 LVHDVDLQLRRGEVCTLVGASGSGKSLSCLGLLDLLPpGLARTQGQLLLDGQPLAAS------SVRGRLTSLVLQNPRSA 93
gi 14579316 318 LVSHLNLSIKCGECVALLGKSGSGKSISALALQGFLAsNLSQTSGKIMLDDKVINPS------FYRSLAFSCIMQNPRTC 391
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 52004377 107 FTPVFTIGQQMTESIRSHTSFSkKQAKELATEALHHVNLPHPAKLLHSYPFQLSGGMLQRVMIAIASCLKPAILIADEPT 186
gi 34483091 101 FNPLFSMKNQMLETLMLALSLEtKKATKLILEAFEKVNLREGEEILEKYPHQLSGGMLQRIMIALCIALSPAVIIADEPT 180
gi 19917507 114 LNPLLTIGEQLMETILIHEKITkKQARAIALNQLLAVSLPQPEELMKKYPFMLSGGMCQRVMIAIASVFHPPLLIADEPT 193
gi 12331183  91 FNPVRTMRDHAIETLQALGKLS-SNPQDQIVHCMRAAGLEDVKTILSLHPFEMSGGMLQRMMIALALLSEAPFLFADEPT 169
gi 34395957  92 FNPLHTMHTHARETCLALGKPA-DDAT--LTAAIEAVGLENAARVLKLYPFEMSGGMLQRMMIAMAVLCESPFIIADEPT 168
gi 60390564  94 FNPVRNMASHAIETLRQRGITS-AVARARMAHCLDAVGLADTERVLQSFAFQLSGGMLQRMMIALALMAETPFLLADEPT 172
gi 14579316 392 FNPLLSIAHHFKETLKSLHKPY-NQPF--IVQCLQESGLD--KQVLDMYPFELSGGMLQRVMIALALLTQAPFLIADEPS 466
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 52004377 187 TALDVYNQKTVLKYLDGMRSDFGTAILLISHDLGVIAEMADEVAVMQNGRIVENRDVFQLFD--EPKHEYTKKLLSARL 263
gi 34483091 181 TAIDVANQVEVLKEFRRIRELFGTSMIFISHDLSVLSQIADELLVMCQGEVIERGTPKEIIV--NPTHKTSQELIGRRL 257
gi 19917507 194 TALDVTVQAQILYQLDSMRKRDGTAILLITHDLGVVAEIADEVCIMKDGQIVERGTVDDIFY--NPQNMYTRKLLAAAL 270
gi 12331183 170 TDLDLVVQLRVLELLEKLVEERDLGILLVTHDMGVVARLAHDVAVLDHGRLIEQAPVMDIFQ--TPGHEVTRMLVSAHL 246
gi 34395957 169 TDLDVVAQARILDLLESIMQKQAPGMLLVTHDMGVVARLADDVAVMSDGKIVEQGDVETLFN--APKHTVTRSLVSAHL 245
gi 60390564 173 SDLDALSQARFLDLLMELVQVHGLGVLLVTHDMGVVARCADQVAVMEAGRIVECQPAHELFQ--RPASATARTLLHAHQ 249
gi 14579316 467 SDLDKDIAFEILKTLRELQQQRGLGILLITHDLRVVAYMAQYVYVMDKGKIIEEVSLCKDFYsySPKSTTIKHLKHICE 545
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap