Conserved Protein Domain Family
TrbL_P

?
TIGR02783: TrbL_P 
P-type conjugative transfer protein TrbL
The TrbL protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbL is a homolog of the F-type TraG protein (which is believed to be a mating pair stabilization pore-forming protein, pfam07916) as well as the vir system VirB6 protein. [Cellular processes, Conjugation]
Statistics
?
PSSM-Id: 131830
View PSSM: TIGR02783
Aligned: 7 rows
Threshold Bit Score: 221.889
Threshold Setting Gi: 218667889
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46916700   18 AQNNNALDDLLGQFHTQTALWEPIILQSMWGLFWGLAVISLVWNAIQLVLHDKGIVDFIAFLFNRVMTIGLSVWLITNAS 97
gi 9107166    27 VDSVGLFDNILGRFHQVADTWSGEIVRYASWLFWSLALLSMVWTYGMMALRKADIQEFLAETIRFFAVMGFFWWLLINAP 106
gi 23463714   29 AQSNTSMNSLLRLIQNASNQWAPRLHDYALWLLGCLAVIQLVWTFAPLVMRGAELGDLLHELVKYILVIGFFYAMLDHAT 108
gi 3766181    29 AQQGTVLTTLENQVVTAAKGWETTILNAARSLFWILAGIEIGIAAVWLAINAASLDAWFAELVRRIMFIGLFAFILERGP 108
gi 27356568    1 MNNVGVIDTFLNTFTTYIDSGFGLIKGEVTYLSSTLIVIDITLAGLFWAW--GADEDILQRLVKKTLYIGFFAFIITNFT 78
gi 50878024  102 NSLINFIQQTVSIFATNAEIVGNRMEILALDIFQLLLLAEVIWLGLRMALKISDFKDTVIEFVKVLLVASLVLYIIKNHA 181
gi 501634974  24 AAGSGSLSQVQSLLRGKILPWQSVMQTAATDLFYVLAAVEFSVLFLNHVLQKRGHEDLFAGIIKKVVTLGFFLTLLDNSG 103
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46916700   98 ALAWAIINTFQKvAGLLSTNQEg----FSPSNVFELGLSIA-----HKVYSSAS--------GFS--------------- 145
gi 9107166   107 AMSTAIIDSLRQiAANATGLGNt----LSPSGIVDIGFDIT-----SKVIDDSS--------IRS--------------- 154
gi 23463714  109 EWGGAIVNSFRQaGAHAAGLGSa---eLMPGDMFSTAVDFS-----RQVLTAGVs-------MFS--------------- 158
gi 3766181   109 ALAKAVVDSLFQiGAGGGS--------ASPANIFDAGIRVA-----SKMSEQAKf------gLFE--------------- 154
gi 27356568   79 KLSGIIFNSFAGlGLKAGGSSIstadfLRPGRLAQVGLDAG-----QPLLDSASqmmg-ftsFFS--------------- 137
gi 50878024  182 EWINALSYGLTAsYDGSLASSTs----QSPETVVLNAIFIYi----EALLNKLH--------ITS--------------- 230
gi 501634974 104 TWIPDIINGLAG-GAHALGVTA-----VTPGQIATEALQAFlgivlSPIAAATHnlgntfsdIFSgnfsaafssagkava 177
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46916700  146 ---IGDNIVLGICALIILV---V-FAMIAAEMCILIVGAYVLVSSGVIVMAFLGSEWTRDHAMNYFTTVLGMAVQLFVMQ 218
gi 9107166   155 ---PVNSAVGIIASTVILI---V-LALIGVNMLLLLVSGWLLSYGAVFLLGFGGGRWTSDIAISYYKTVIGLGMQLFAMI 227
gi 23463714  159 ---PITSVVVAVSALIVPM---C-FTFIAALVFVTLVEAYVIINAAVLFMGFGGSQWTREYALAPIRYAVAVGAKLFVLT 231
gi 3766181   155 ---DNALAIAAVFAMVVVV---VsFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSYTKDFAVRYLVYAFSVGMKLMALV 228
gi 27356568  138 ---NFVQIAVLMVSWLLVL---IaFFILAVQLFVTLIEFKLTTLAGFILIPFALFNKTAFLAEKVLGNVVASGVKVMVLA 211
gi 50878024  231 ---PIDATFILLGVLVIAI---C-AAFITVTIVCILIEAYFVLNISVILLGFGALKFTREFTWNYLKYILSVGLKLLTIK 303
gi 501634974 178 ssnPASLLVETLLAGIIGLlagVgILVMALEFLMVQIESYLVIALGVIMLAGGGLRWTAKYVGSYFDYAINVGVRLFILT 257
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 46916700  219 LII-IIGYSMFSGFMT-----QAGTGSADYLVMVGMCIVYFALVRVVPNMATSLATGRFV-----------FGSGSAVAA 281
gi 9107166   228 LII-GIGKSFIDQYYAav--sTGAITMKALLVMLVASIVLLALVNKIPPMFASIVGGGGAtag-----ignFGAGAAIAA 299
gi 23463714  232 LIV-GLIMQVSAEWSA-----AYTNDEASLMTLVGLSLVCAYLTKTIPELIGGMISGTSMgggs---aiggMAAAGAAGA 302
gi 3766181   229 MIA-KIGSDILIGLAEap--tATSDQFITTLAIAGISVVVFVIAMYVPPIIQGVVQGASV-------------SGGMEAI 292
gi 27356568  212 VIV-GIGTGLFSQFTTay--aGGQPTIEQALSVVLAALAMLGLGIFGPGIATGLVSGAPQ-----------LGAGATVGT 277
gi 50878024  304 VLA-NFISSFFASAHNplavpAGDIGIQYMIHAIICMVVITGIFKTIPTTVASFVTNAG------------IGSNPIGAV 370
gi 501634974 258 ALAyLVTYSIVPLIQTil--eNVTNPLQAGFEVLILGALIALLPRKASSIASSLLSGNSSfsggelakeggMIAGGTVAL 335
                        330       340       350
                 ....*....|....*....|....*....|.
gi 46916700  282 ATSVAG--AAAGAALLGAGAFGAMKGGIGNL 310
gi 9107166   300 AATGAAv-AATAGSALAAGLSSAGGGVSALK 329
gi 23463714  303 AAAIATv-ATSGAAAPAAGALGAAGTGGGAA 332
gi 3766181   293 RHGGQTaaFAAGGAFLGAGA--AMKGAQSAS 321
gi 27356568  278 GLAVAGt-AMVGGAALGLAGRGAMAASSGAA 307
gi 50878024  371 VATVAGv-AATG---KMAGASSKKAGAVAAA 397
gi 501634974 336 GAAGVGl-AAAAGGGLAAGGLSAAAGAGGGA 365
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap