Conserved Protein Domain Family
nickel_nikC

?
TIGR02790: nickel_nikC 
nickel ABC transporter, permease subunit NikC
This family consists of the NikC family of nickel ABC transporter permeases. Operons that contain this protein also contain a homologous permease subunit NikB. Nickel is used in cells as part of urease or certain hydrogenases or superoxide dismutases. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131837
View PSSM: TIGR02790
Aligned: 6 rows
Threshold Bit Score: 362.858
Threshold Setting Gi: 462712
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19917514  32 AVSGILLIAVLCVLALFAPKLAPHDPLAQRLDSRLLSPSLEYPFGTDELGRCIFSRVIYGTRISLGIGLLVVAVTSIAGT 111
gi 10173183  15 VVVCSVILFVFFLLAILAPWIAPHDPIQVNLALKLLPPSWEYPLGTDQLGRCNLSRLLFGARVSLGFATLIFISSLGIGL 94
gi 34483090  11 GAMALAILLVVFIMGIFASFFALHDPLEQNILMKFAGVSMEYPFGTDHLGRCIYSRMVFGIQNTVFLALLTMVCAIVIGV 90
gi 19917508  31 AVFGLLIVALIIFVAIAASVIAPNDPLKVNMSMRFKGPSSLYWLGTDNLGRCIASRLIWGARMSLIYSLCVLGLMMAIST 110
gi 462712    11 VRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLGRDIFSRLMAATRVSLGSVMACLLLVLTLGL 90
gi 14579316  11 GKSAFVGVGIIVFLALFAPFLTSYAPDMQDLEHRLSPISMHHWLGTDYLGRDIFSRLLYGARLSLGCAFIILGWIVLLGV 90
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19917514 112 SLGLLSGYRGGVLDEAIMRGVDIVMAFPNIILALVIAGLMGPGFSSVVFALVFTQWPAYARLVRGQVLSLRKRAFVEAAR 191
gi 10173183  95 LVGAIAGYRGGWIDSVLMRFCEGVMAFPNLVLVLGLVGLFGPGLWQVVLALVMVQWVYYARMFRSMIVSLKEQNFITAAR 174
gi 34483090  91 LVGIVAGYYGGVVDEVIMRFCDVMLSFPSQVMILAIVGIMGVGIENIIIANILIKWTWYARMIRGIVVSYAHKNYVLYAK 170
gi 19917508 111 PIGLLSGYAGGRMDTFIMRVTDIFLSLPTFLMALAIAGMLGPSVKNMIIAMASVWWAPYARIIRGMAMQIKQQDFMLAAK 190
gi 462712    91 VIGGSAGLIGGRVDQATMRVADMFMTFPTSILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASR 170
gi 14579316  91 SIGGICGFIGGRVDNIFMRVCDVFLSMPTIALSLFLVGILGAGLENVMIAIVLTHWAWYARIVRSVVFSLKNKEYVLLSY 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19917514 192 ALRPSSFYIMRKHILPNCMEPVIVLGTLEIAHVIIFASALSFLGLGIQPPVPEWGSMLKAGIPYLRTAPHLTFFPGLMII 271
gi 10173183 175 ISGSSPWKIIRRHIIPNVLPPIVVIGTLEMGWAIMDISALSFLGLGIQPPTPEWGAMIHEGKSFIRSHPELMLYPGIMIL 254
gi 34483090 171 TIGKSDSFIISRHLVPSITSEIIILGTLDIGWVIINISTLSFLGLGIQPPFPEWGAMLGEAKNTLITQPAQMIAPGMAIL 250
gi 19917508 191 AAACTHCQIIFRHILRNIASPIIVMATLEIGSIILAIASFSFIGLGAQPPTPEWGIMLSDSKEFMQTQPQLMIYPGIAIL 270
gi 462712   171 LSGAGHVRVFVDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPLQMFWPGLALF 250
gi 14579316 171 TFGASGWQRFKRHILSPILCQCIVLASMDLGHIMLHIAGLSFLGLGVQPPTPEWGIMLSEAKDYMWDYPSLIIYPGVALF 250
                       250
                ....*....|....*...
gi 19917514 272 FTVFAFNFAGDGLRDNLG 289
gi 10173183 255 LVVMTFNVLGESLSGRFG 272
gi 34483090 251 TVVACFNILGDSLRDILD 268
gi 19917508 271 FTVMAFNLLGEGLKNAIQ 288
gi 462712   251 ISVMAFNLVGDALRDHLD 268
gi 14579316 251 ISVGLCNLLGEALRDYFG 268
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap