Conserved Protein Domain Family
exbB

?
TIGR02797: exbB 
tonB-system energizer ExbB
This model describes ExbB proteins, part of the MotA/TolQ/ExbB protein family. The paired proteins MotA and MotB, TolQ and TolR, and ExbB and ExbD harness the proton-motive force to drive the flagellar motor, energize the Tol-Pal system, or energize TonB, respectively. Tol-Pal and TonB are both active at the outer membrane. Genomes may have many different TonB-dependent receptors, of which many of those characterized are involved in siderophore transport across the outer membrane. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131844
View PSSM: TIGR02797
Aligned: 10 rows
Threshold Bit Score: 323.197
Threshold Setting Gi: 27355354
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39650196  78 SPIGMFIAADWVVKAVMIALLLASFLSWTICVAKAVEVACANARAKRAFLIVDRSRDLDEAVHRLSKRG--GPAVFMVRS 155
gi 15074444  87 SPVGMFLAADIVVKAVMVALALASVATWAIFLVKTLELIYAKSRLKRAVAALVSANGLAEVQSKLERRA--GVAGEMVAA 164
gi 17738485  83 SPWGMFMAADWVVKGVMIGLAFASLVTWTVWVAKSIELAGARVRAGSTLKVIRRAKTLAEATDAVENKG--GPAALMLRM 160
gi 12802721  89 SPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSATLNDAVHALDGAK--GPGAAFVRA 166
gi 14024280  21 SPWGMFIAADIIVKAVMIGLAFASLVTWTIWLAKSLEILGGKLRIRRAVRAIGDAATLKQASRALGRSG--GPGALLVKA 98
gi 78099975  11 SVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARSLNQANDIAADFGskSLSLHLLNE 90
gi 585111   102 SPWGMYKNADIVVKIVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIAQLKKSASLKEASEVSNKEG--TLAHTLVHD 179
gi 39650396   9 SPWTMFLNADIIVKIVMIGLAISSVITWTIFIAKKVELGRARFRLRRSLKEIGESRSLAEAQMALGDKH--SVLSMLLAA 86
gi 27355354  39 SPWGMFLGADIIVKTVMIGLAVASVVTWTVWLAKTVELRRKSALAVQRTRALEGRMKLAEAAERTGDAH--DAVAQLIQS 116
gi 58001416   6 SPWQMFLDAGPVVRGVMTILAMASLVTWTIFIAKTIELQRLRSRLKKSEITLEDAETLDIGEEWTRTGSgsGIAHAMVMA 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 39650196 156 ASEELHRSLPvlAYSGEAGLKERVVSRLARIEAQAGRRLMRGTGLLATVGAVSPFVGLFGTVWGIMNAFIGISQSHTTNL 235
gi 15074444 165 AIDEMTRSEAvlDLAPAVGVKERVSSLLTRIEVRAGKRMSAGTGILASIGSVGPFVGLFGTVWGIMNSFIGISKAQTTNL 244
gi 17738485 161 ATHEMQLSDAvvEHTDGGGIKERVSSALSRIETHAGRRMSRGTGALATIGSTAPFVGLFGTVWGIMNSFISISESQTTNL 240
gi 12802721 167 AEDEVRLSGPalARAGGEGLKERVASRLSRIEAKAGRRLAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNL 246
gi 14024280  99 AEEETALSAGalDHVGGDGLKERVTSRLSRIEAAASRRMSRGTGVLATIGSTAPFVGLFGTVWGIMNAFIGISQAQTTNL 178
gi 78099975  91 AQNELELSE---GSDDNEGIKERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNL 167
gi 585111   180 ALEEMRLSA---NTREKEGIKERVAFRLERLVAASGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNL 256
gi 39650396  87 ALREAKLSA---GLSSDEGIKERAASSFSEYVRAEGRHMRRGMGFLATIGATAPFIGLFGTVWGIMNSFIGISKSQTTNL 163
gi 27355354 117 CAKEAELSG----GIVDDGLQERVALRLERVEAAMSRQIARGTGVLATIGATAPFVGLFGTVWGIMNAFIGISESHTTSL 192
gi 58001416  86 AEVERQRSQD--IPGDREGIKERIVLHLERLEAAEGRRLMRGTGVLATIGATSPFVGLFGTVWGIMSSFTGIAAAHATSL 163
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*
gi 39650196 236 AVVAPGIAEALLATAFGLVAAIPAVIIYNVFARAISGYRQVLADAAAGVERLISL 290
gi 15074444 245 AIVAPGIAEALLATAIGLVAAIPAVVIYNYFARSVGGYKLILADAAAAVERLVSR 299
gi 17738485 241 AVVAPGIAEALLATAIGLVAAIPAVVIYNVFARSITGYRHLLADAAAGVERLVSR 295
gi 12802721 247 AVVAPGIAEALLATAIGLVAAIPAVVIYNVFARSITGYRALLADASAGVERLVSR 301
gi 14024280 179 AVVAPGIAEALLATAMGLVAAIPAVVIYNVFARSIAGYRQILADASAGVERLVSR 233
gi 78099975 168 AVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSR 222
gi 585111   257 AVVAPGIAEALLATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSR 311
gi 39650396 164 AVVAPGIAEALLATAIGLVAAIPAVIIYNHFSREIKLYLELVARASGAAGRLLSR 218
gi 27355354 193 AVVAPGIAEALLATALGLVAAIPAVVIYNHLVRGIANYRALLGDASAQLMLLVSR 247
gi 58001416 164 AVVAPGIAEALLATALGLVAAIPAVVIYNHLARQTAACRACLADLTSLVMRLVSR 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap