Conserved Protein Domain Family
ligK_PcmE

?
TIGR02798: ligK_PcmE 
4-carboxy-4-hydroxy-2-oxoadipate aldolase/oxaloacetate decarboxylase
Members of this protein family 4-carboxy-4-hydroxy-2-oxoadipate aldolase, also called 4-oxalocitramalate aldolase. This enzyme of the protocatechuate 4,5-cleavage pathway converts its substrate to pyruvate plus oxaloacetate. Protocatechuate is an intermediate in many pathways for degrading aromatic compounds, including lignin, fluorene, etc. Hara, et al. showed the LigK gene was not only a 4-carboxy-4-hydroxy-2-oxoadipate aldolase but also the enzyme of the following step, oxaloacetate decarboxylase.
Statistics
?
PSSM-Id: 131845
View PSSM: TIGR02798
Aligned: 5 rows
Threshold Bit Score: 341.439
Threshold Setting Gi: 13242045
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7573254    3 GIVVQNIERASLSVVDGLAKCGVATVHEAQGRTGLLAPTMRPIYTGARIAGSAVTISAPPGDNWMVHVAIEQLKEGDVLL 82
gi 19918963   7 GVVVQNIERAPLEVIDGLAACGVATVHEAQGRTGLLASYMRPIYRGARVAGSALTISAPPGDNWMVHVAIEQLKAGDILL 86
gi 14861214   5 GVVYRNIQRADRAAADGLAALGSATVHEAMGRVGLLKPYMRPIYAGKQVSGTAVTVLLQPGDNWMMHVAAEQIQPGDIVV 84
gi 39651616   9 GIVKRNITRANKAAVEKLSRFGVATVHEAMGRVGLMQPYMRPIYQGAHICGTAVTVLLQPGDNWMMHVVAEQIQPGDVVV 88
gi 13242045   7 GIVRTNIERPDPADVKRLSQFGVATIHEAMGRVGLLRPYIRPAYTGAKLCGPAVTVLLQPGDNWMFHVAAEQVQEGDVIV 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 7573254   83 LAPTSPCTDGYFGDLLATSAQARGCRGLIIDAGVRDVRDLKQMNFPVWSKAIHAQGTIKATLGSVNIPVVCANALVNPGD 162
gi 19918963  87 LAPTSPCEDGYFGDLLATSAQARGCRGLVIDAGVRDVRDLTEMNFPVWSKAIYAQGTVKNTLGSVNVPVVCANALVNPGD 166
gi 14861214  85 AAVTAECSDGYFGDLLATSFQARGARALIIDAGVRDVKTLQEMDFPVWSKAISSKGTIKATLGSVNIPIVCAGMLVTPGD 164
gi 39651616  89 AACTADSTDGFFGDLLATSFRARGALGLIIDAGVRDVRDLTQMNFPVWSKAIHAKGTVKATLGSVNIPVVAAGAHITPGD 168
gi 13242045  87 AGCTTESEDGFFGELLATSLTARGCKGLVIDGGVRDVADLEKMDFPVFSRAVNAKGTVKATLGSVNIPVVVANAVVNPGD 166
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 7573254  163 VVIADDDGVCVVPRANAAAVLEKAQAREAAEEAKRVRLASGELGLDIYNMRPRLEEMGLKYV 224
gi 19918963 167 VIVADDDGVCVVPLANAEKVLEAARAREANEGDKREKMANGVLGLDLYKMRERLEKEGLKYV 228
gi 14861214 165 VIVADDDGVVCVPAARAVEVLAAAQKRESFEGEKRAKLASGVLGLDMYKMREPLEKAGLKYI 226
gi 39651616 169 VVIADDDGVVVVPAAVAQMAADAAEAREANEADKRAKLASGVLGLDMYKMREPLEKAGLKYI 230
gi 13242045 167 VVVADVDGVVVVPRELVGAVADASQKREDNEEAKRVKFREGVLGLDVYGMRGPLAKAGLEYV 228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap