Conserved Protein Domain Family
ExbD_1

?
TIGR02803: ExbD_1 
TonB system transport protein ExbD, group 1
Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Statistics
?
PSSM-Id: 131850
View PSSM: TIGR02803
Aligned: 4 rows
Threshold Bit Score: 181.183
Threshold Setting Gi: 23348524
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 14595285  15 NHEINVTPFIDVMLVLLIIFMVAAPLATVDIKVDLPASTAKPAPRPEKPVFVSVKADQKLYVGDDQVAApDQLGPMLDAK 94
gi 39649048  18 AHEINVTPFIDVMLVLLIVFMVAAPLATVDVGVDLPASTAAPQPRPEKPIFVSLKPDLSLALGEEMVPR-EALTSALDSV 96
gi 23348524  16 NHEINVTPFIDVMLVLLIIFMVAAPLATVDVKVDLPASAAAPAPRPDKPLYVTLKEDLSVSVGNDTVAR-ERLGAALDGL 94
gi 78099979  15 MHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTD-ETMITALNAL 93
                        90       100       110       120
                ....*....|....*....|....*....|....*....|...
gi 14595285  95 TKGDKETTIFFQADKGVDYGDLMEVMNNMRAAGYLKVGLVGLE 137
gi 39649048  97 TGGNKDERIFLRADKAVSYGDLMAAMNLLRDAGYLKVALVGLD 139
gi 23348524  95 SEKDKETRIFLRADKNVAYGELMRVMNLLREAGYLKIALVGLE 137
gi 78099979  94 TEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGEE 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap