Conserved Protein Domain Family
exbB2

?
TIGR02805: exbB2 
tonB-system energizer ExbB, group 2
Members of this protein family appear to be the ExbB protein of an ExbBD proton-transporting membrane complex that, by means of TonB, energizes transport by TonB-dependent receptors. Note that this family represents one of at least two distinct groups TolQ homologs designated ExbB - see also TIGR02797. Each group associates with a distinct group of ExbD proteins, and a single species may have two ExbB/ExbD/TonB systems. [Transport and binding proteins, Cations and iron carrying compounds]
Statistics
?
PSSM-Id: 131852
View PSSM: TIGR02805
Aligned: 3 rows
Threshold Bit Score: 195
Threshold Setting Gi: 1169576
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1169576    6 DFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLRKVSVAHYSTIHALDIDLNRNMTVISTIGANAPYVGLLGTVIGILLT 85
gi 57167444   2 EFLKDYIDLIIFLILGIMAFIAFWCVVERMLFFRKINFKNYENQEQFDDAISENLTTIYIIYSNAPYIGLLGTVIGIMVT 81
gi 34483492   2 HLIKAYMDHAIFGILGFMSLLALAYAIERFLYYKNIKVDRYKDVNQLENDLTQNLTILSIIGSNAPYIGLLGTVIGIMVT 81
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 1169576   86 FYQIGHGGGdIDPSVIMLHLSLALKATALGILVAIPSMVFYNGLGRKVEVNRLKWKVLS 144
gi 57167444  82 FYEMGLAGN-IDVKSIVVGLSLALKATALGLLVAIPALMAYNALLRRVSLLSNAYKANK 139
gi 34483492  82 FYDMGSGAG-IDTNAVLIGLSLALKATALGLLVAIPTLIVYTACLRKVDVHIAAWKSLD 139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap