Conserved Protein Domain Family
clostrip

?
TIGR02806: clostrip 
clostripain
Clostripain is a cysteine protease characterized from Clostridium histolyticum, and also known from Clostridium perfringens. It is a heterodimer processed from a single precursor polypeptide, specific for Arg-|-Xaa peptide bonds. The older term alpha-clostripain refers to the most active, most reduced form, rather than to the product of one of several different genes. Clostripain belongs to the peptidase family C11, or clostripain family (see pfam03415). [Protein fate, Degradation of proteins, peptides, and glycopeptides, Cellular processes, Pathogenesis]
Statistics
?
PSSM-Id: 131853
View PSSM: TIGR02806
Aligned: 2 rows
Threshold Bit Score: 939.462
Threshold Setting Gi: 399264
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399264    55 KVTIMYYCDADNNLEGSLLNDIEEMKTGYKDSPNLNLIALVDRSPRYSSDEKVLGEDFSDTRLYKIEHNKANRLDGKNEF 134
gi 18144506  54 KLTVMVYADCDNNLEEYILNDIEEMKEGYKNNPNLNIIVLVDRIPGYSNDSKVLGSNFEDTRLYKIGENSAERISGKSEF 133
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399264   135 PEISTTSKYEANMGDPEVLKKFIDYCKSNYEADKYVLIMANHGGGAREKSN--PRLNRAICWDDSNLDkngeaDCLYMGE 212
gi 18144506 134 PEITTTSNYEANMGDANTLKKFIKFCKKNYEADKYMLIMSNHGGGAKDDKDraSTVNKAICWDDSNNK-----DCLYTGE 208
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399264   213 ISDHLTEKQSVDLLAFDACLMGTAEVAYQYRPGNGGFSADTLVASSPVVWGPGFKYDKIFDRIKAGGGTNNEDDLTLGGK 292
gi 18144506 209 ISDVLTKDESVDVLVFDACLMGNSEVAYQYRPNNGSFEAKTLVASAPVVWGFGYPYDKIFSRLRSTKGDNGEVDSTLGGK 288
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399264   293 EQNFDPATITNEQLGALFVEEQRDSTHANGRYDQHLSFYDLKKAESVKRAIDNLAVNLSNENKKSEIEKLRGSGIHTDLM 372
gi 18144506 289 EKIFDPSTVTNNELGALFVEEQRDSVNSCRVTDQQLSCYDLSKIEKVKKSVDALARNLSKNNKKDAIEKLRGTGKNAPTM 368
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 399264   373 HYFDEYSEGEWVEYPYFDVYDLCEKINKSENFSSKTKDLASNAMNKLNEMIVYSFGDPSNN-FKEGKNGLSIFLPNGDKK 451
gi 18144506 369 HYFKNYDEYEWIEYPYFDLYDLCEKISLSDEFNETTKKLSKNVMKNVDQLILYSFAGKDFKgFKEGKNGISIFLPDGNRN 448
                       410       420       430       440       450       460       470
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 399264   452 YSTYYTSTKIPHWTMQSWYNSIDTVKYGLNP-YGKLSWCKDGQDPEINKVGNWFELLDSWFDKTNDVTGGVNHYQW 526
gi 18144506 449 YYDQYSGQAIPHWAIQRWYNPLDTNAYRLRSgYGKLAWCKDGLDPKINKVGNWFELLDSWFDKDNTSLGGYNRYRY 524
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap