Conserved Protein Domain Family
pfaB_fam

?
TIGR02816: pfaB_fam 
PfaB family protein
The protein PfaB is part of four gene locus, similar to polyketide biosynthesis systems, responsible for omega-3 polyunsaturated fatty acid biosynthesis in several high pressure and/or cold-adapted bacteria. The fairly permissive trusted cutoff set for this model allows detection of homologs encoded near homologs to other proteins of the locus: PfaA, PfaC, and/or PfaD. The likely role in every case is either polyunsaturated fatty acid or polyketide biosynthesis.
Statistics
?
PSSM-Id: 131863
View PSSM: TIGR02816
Aligned: 2 rows
Threshold Bit Score: 988.437
Threshold Setting Gi: 15488032
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2529419  210 SHYWFSEFHQNRVAAINF-INGQQATSYVLTQGSGLLAAKSMLNQQRLMFILPGNSQQQITASITQLMQQLERLQvtevN 288
gi 15488032 162 SHYWFTEPHKARVASLTFnANSDSESSLVLTQATGLQKAQSLLNASRLFFVLSGLNEIELSVQLEQLKQRLADLP----N 237
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2529419  289 ELSLECQLELLSIMYDNLVNADKLTTRDSKPAY---QAVIQASSVSAAKQELSALNDALTALFAEQTnatstnkgliQYK 365
gi 15488032 238 DLTPNDNAALIALMTKNLAQYQTDVSSSATSSIslpTIVLQGASVTAVLQEISAISNALPKVIAEKS----------HYK 307
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2529419  366 TPAGSYLTLTPlgsnndNAQAGLAFVYPGVGTVYADMLNELHQYFPALYAKLEREGDLKAMLQAEDIYHLDPkhaAQMSL 445
gi 15488032 308 TPAGSCFSPAP------NSKGGVTFVYPGVGTVYPGMFRDFHQYFPALFAQLEREGNLKEMLQAEKTYGENP---AEMTL 378
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2529419  446 GDLAIAGVGSSYLLTQLLTDEFNIKPNFALGYSMGEASMWASLGVWQNPHALISKTQTDPLFTSAISGKLTAVRQAWQLD 525
gi 15488032 379 GELAIAGVGSSYLLTQLLCEEFAVKPDFALGYSKGEASMWASLGVWKNPHALIELTQTSPIFTTAISGKLTAVREAWQLT 458
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2529419  526 DtAAEIQWNSFVVRSEAAPIEALLKDYPHAYLAIIQGDTCVIAGCEIQCKALLAALGKRGIAANRVTAMHTQPAMQEHQN 605
gi 15488032 459 D-AEEITWNSFVVRCESATIEALLPEFPRAYLAIIQGDTCVLAGCEATCRALLKKLGKRGIAANRVTAMHTTPALSQHSQ 537
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2529419  606 VMDFYLQPLKAELPSEISFISAADLTAKQTVSEQALSSQVVAQSIADTFCQTLDFTALVHHAQHQGAKLFVEIGADRQNC 685
gi 15488032 538 VTEFYTQPLCDELPMDIKFISAAGLLPQNQNVPVNIDSQSIANSIADTFCTTLDFTALIRTAREQGARLFVEIGADRQTS 617
                       490       500       510       520       530
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 2529419  686 TLIDKIVKQDGASSVQhqpcCTVPMNAKGSQDITSVIKALGQLISHQVPLSVQPFIDG 743
gi 15488032 618 TLIDKINRTDNVTTES----CTVAANAKGGEDIVTLLKCIAQLITHQIPLSLSPLLQG 671
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap