1ZSV


Conserved Protein Domain Family
B4_12hDH

?
TIGR02825: B4_12hDH 
Click on image for an interactive view with Cn3D
leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase
Leukotriene B4 12-hydroxydehydrogenase is an NADP-dependent enzyme of arachidonic acid metabolism, responsible for converting leukotriene B4 to the much less active metabolite 12-oxo-leukotriene B4. The BRENDA database lists leukotriene B4 12-hydroxydehydrogenase as one of the synonyms of 2-alkenal reductase (EC 1.3.1.74), while 1.3.1.48 is 15-oxoprostaglandin 13-reductase.
Statistics
?
PSSM-Id: 131872
View PSSM: TIGR02825
Aligned: 4 rows
Threshold Bit Score: 653.987
Threshold Setting Gi: 23503081
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZSV_A       24 TKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGT 103
gi 73621182   4 AKSWTLKKHFEGFPTDGNFELKTTELPPLNNGEVLLEALFLSVDPYMRVAAKKLKEGDRMMGEQVARVVESKNSAFPKGT 83
gi 2498510    4 AKNWTLKKHFHGHPTDSDFELKTVELPPLNNGEVLLEALFLSVDPYMRLGSKRLKEGDTMMGQQVARVVESKNPAWPVGT 83
gi 23503081   4 TKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGT 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZSV_A      104 IVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAK 183
gi 73621182  84 IVAALLGWTSHSISDGNGLTKLPVEWPDKLPLSLALGTVGMPGLTAYFGLLDICGVKGGETVMVSAAAGAVGSVVGQIAK 163
gi 2498510   84 LVLAHSGWASHSISDGQQLEKLLTEWPDTLPLSLALGTVGMPGITAYFGLLEICGAKSGDTVLVNAAAGAVGAVVGQIAK 163
gi 23503081  84 IVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAK 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZSV_A      184 LKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAIS 263
gi 73621182 164 LKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEALRTASPDGYDCYFDNVGGEFSNAVILQMKTFGRIAICGAIS 243
gi 2498510  164 IKGCRVVGAAGSEEKVDYLKKIGFDFAFNYKTVKSLEETLKKAAPDGYDCYFDNVGGEFSNTVIRQMKKFGRVAICGAIS 243
gi 23503081 164 LKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAIS 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1ZSV_A      264 TYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLG 343
gi 73621182 244 QYNRTGPCPQGPAPEVVIYQQLRMEGFIVNRWQGEVRQKALTELMNWVSEGKVQCHEYVTEGFEKMPAAFMGMLKGENLG 323
gi 2498510  244 MYNSTGQLPPGPSPESVLYQEIRMEGFIFNRWKGEVGQKALKELLTWVLEGKIQYREFVIEGFENMPAAFMRMLKGENVG 323
gi 23503081 244 TYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLG 323

                ....*
1ZSV_A      344 KTIVK 348
gi 73621182 324 KTIVK 328
gi 2498510  324 KARSE 328
gi 23503081 324 KTIVK 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap