Conserved Protein Domain Family
spo_II_M

?
TIGR02831: spo_II_M 
stage II sporulation protein M
A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This predicted integral membrane protein is designated stage II sporulation protein M. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131878
View PSSM: TIGR02831
Aligned: 9 rows
Threshold Bit Score: 179.379
Threshold Setting Gi: 20516316
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586019     8 DMFLRHVKDHLSLYIFVSVLFFMGVIFGAIIVNSMTISQKEDLYYYLSQFFGQLS-DGKQASSADMFGQSIFHNAKYLGL 86
gi 22777534   5 YVVFNHFKHHATIYIFTTILFLTGIVFGAVIVNSMDVVQKQDLFFYLERFFIQTTeEGSTLNNNDILWQSFFYHIKYLGL 84
gi 29897736   8 DRVMSHIQENSSLYIFNAVLLLMGVIFGAILVNSLQINQKQDLSFYLQRFFGQVS-KGEFAIAGEMFRESYFSQLKYIGF 86
gi 10174143  12 ESMHRHLYDNQAIYLFTIVLFLVGIVFGAIVVNSLSITQKHDLYMYLQQFFGQVS-DGHVATSTEMFKQSFSHYAKYFGL 90
gi 15025055   7 EAISNHIKERFWLYIISSLSIGIGFVISVYTVKYMSSYEKNDLMSYILNFTKNK--GTVSINYNGVLFQTLKDNIPLIII 84
gi 28203643   8 NSLADHFRENFWIYVVTLLFIFIGIVLGIYSVKYINSVHSNELLNYFNNFINHI--GNNNIEYKTVFYQILKNNIPTIFI 85
gi 18145472   6 SGLMESLKENKITFLWVLLFFLVGIVLGSYTVYYMSDFNRVEITTYFNNFLEFL--GGNSVSYTSILIDSIKSILPMVAI 83
gi 20516316   6 AGFYSHIRGNFFLYVLVLTALMIGTTTGAFTVNNITDIQREQIREYISKFYQIA--KTIELSPVQIFKQSLLNNFVTVFL 83
gi 51856650   9 ENLEELLLERGGLVLWHTALFVVGLLFGALALRSLEVETQLELARQISGALQALR-EGEPPAPGPLLREALFRQARTVAL 87
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586019    87 MWILGISVIGMPIIFIMIFLKGIVVGFTVGFLVNQMGVSGFFLSFVSVLPQNVLLIPAYLIMGTCAIAFSLKLIRQLFVK 166
gi 22777534  85 MFIFALSVIGLPIVWILIFIKGMVVGFSVGFMVNWLGMDGLILSAISIAPQNIVIIPIYIIAGSICMIFSLGLLSKLVAK 164
gi 29897736  87 IWILGISIIGLPLIFILLFVKGVVVGFTVGFLVSQHGWNGLLLAFVSVLPQNLIIIPVFLVMTTIAASFSLRMIRHQFIR 166
gi 10174143  91 MWILGLSIIGLPVILVLLFLKGVVIGFTVGFLVSQMGMNGFFLSFVSVLPQNLILVPAFIIIGTASVSFCLKMIRNQFVK 170
gi 15025055  85 IWFLGLTMIGIPVILIIDLLKGFSLGFTITFFVNNLGIKGVTMAFLGVLPQNLIYIPCILFVSVIAMEFSIGLVRCGFND 164
gi 28203643  86 IWFLGMTLVGLPGILIIDILKGYTFGFTISFLINSNGIKGLWMVLLALIPQNIIYISCILVASVLAMDFSLNFVKERVNK 165
gi 18145472  84 IVLLGYTAVGTPIILMMDLAKGYVIGFTFSLIVSMLGSKGIMLVLSGLMLQNLIFIPIIMLISVLAIRHSVTKLKMGVSR 163
gi 20516316  84 LWILGATIIGIPFIFLIVGMRGFTLGFSIGVLIKEMQMKGVLLTLLGVLPQNIFILLGILFTSVTAINFSVYLLK---NK 160
gi 51856650  88 MWVLGVSLVGSVAVMALPLVRGFTSGFAVAYLTAELGARGVLLAAAGHLPQTVLEVPGVILAASASVGFAVEVLTSWRVR 167
                       170       180       190       200
                ....*....|....*....|....*....|....*....|..
gi 586019   167 RsLHDAPIQWFGRYAFVLLVILFLALISSLFEAYLSPVLMEK 208
gi 22777534 165 R-NNTSLSQPFIKLTTSFVILIVCTGLAAILEAYISNTMMVE 205
gi 29897736 167 K-ITEPLLPLLIRYTCFFLVIGVVLALASSVEAYASPVLMKE 207
gi 10174143 171 G-INEPFFPQFLQYSMLILCVGASSLIASGIEAYMSPLLMRM 211
gi 15025055 165 G-IRNRIFTRIGSYSLVFAFAAIFMGMGFLFETYCTPNIIKL 205
gi 28203643 166 T-FGQGLGVRILYYSLSFIFIISVMFVGFFMETYVTPSIMKI 206
gi 18145472 164 DrVKLDVSRAYLNFQGLL---SLIIISGILIETYISPNLIRL 202
gi 20516316 161 KfYFEELASQFISYTFAIYAGFLFIMLGCLIESYLTPYVLLL 202
gi 51856650 168 R-RLSGYYDALARYSNTLLCAAVLLAAAALVEGYVTPHLVRL 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap