Conserved Protein Domain Family
spore_sigmaE

?
TIGR02835: spore_sigmaE 
RNA polymerase sigma-E factor
Members of this family comprise the Firmicutes lineage endospore formation-specific sigma factor SigE, also called SpoIIGB and sigma-29. As characterized in Bacillus subtilis, this protein is synthesized as a precursor, specifically in the mother cell compartment, and must cleaved by the SpoIIGA protein to be made active. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131882
View PSSM: TIGR02835
Aligned: 5 rows
Threshold Bit Score: 402.662
Threshold Setting Gi: 20516645
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28203259  28 FKLKVFLNKILSKLKIFARNIYYIGGSDVLPPPLTREEEENLVEKLNYGDESIRSILIERNLRLVVYIARKFENTGIGIE 107
gi 49065843   6 FYLVYLWYKVLLKLGIKTDEIYYIGGSEALPPPLTKEEEEVLLNKLPKGDQAARSLLIERNLRLVVYIARKFENTGINIE 85
gi 20516645   9 IELLLIWRKLLDFLDL-AEEVYYIGGSEALPPPLSVEEESYLISKMEKGDNEAKSILIERNLRLVVYIAKKFENTGVGIE 87
gi 77996800   4 KKFFFWLKNLFKKFFERPGEVYYIGSHDILPPPLSSEEENTLLTLLVQGDAAAKSTLIERNLRLVVYIARKFENTGVNIE 83
gi 51856048  18 RVSTRVLRWLAARGLVRPRAIYYVGSSEALPPPLTGEEEAALLQRLTQGDESVKNTLIERNLRLVVYIARKFDNTGIWVE 97
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28203259 108 DLVSVGTIGLIKAVNTFDPSKKIKLATYASRCIENEILMYLRRNNKIKSEISFYEPLNVDWDGNELLLSDILGTDTDIVY 187
gi 49065843  86 DLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMHLRRNNKNRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIIT 165
gi 20516645  88 DLISIGTIGLIKAINTFNPRKKIKLATYASRCIENEILMYLRRNNKTRLEVSFDEPLNVDWDGNELLLSDILGTDNETVY 167
gi 77996800  84 DLVSIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMYLRRNSKIRLEVSFDEPLNVDWDGNELLLSDVLGTEGDIIY 163
gi 51856048  98 DLVSIGTIGLIKAVKTFDPSKRIKLATYASKCIENEILMYLRRASRTRSEVSFDEPLNKDWEGNELLLSDVMGTDSDITY 177
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 28203259 188 DYIEEEVDKELLLIAMDKLNNREKQIVNLRFGLGGKTEKTQKEVADMLGISQSYISRLEKRIIKRLKKEINKMI 261
gi 49065843 166 KDLEATVDRHLLMKALHQLNDREKQIMELRFGLAGGEEKTQKDVADMLGISQSYISRLEKRIIKRLRKEFNKMV 239
gi 20516645 168 KYIEDEVERELLTSALKKLPDREKKIIRLRFGLEGGTEKTQKEVADMLGISQSYISRLEKKILKRLKKEMNRLV 241
gi 77996800 164 KVMEDEVEKKLLKVALSKLNQRERKIMELRFGLTDGYERTQKEVADLLGISQSYISRLEKKILKRLKKEIIRME 237
gi 51856048 178 RGLEEEVDRMLLRKAMAKLTGREKRIMELRFGLVDGRERTQKEVADLLGISQSYISRLEKRIFKRLKKEILRME 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap