Conserved Protein Domain Family
spore_IV_A

?
TIGR02836: spore_IV_A 
stage IV sporulation protein A
A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131883
View PSSM: TIGR02836
Aligned: 4 rows
Threshold Bit Score: 843.306
Threshold Setting Gi: 28203271
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 464794     1 MEKVDIFKDIAERTGGDIYLGVVGAVRTGKSTFIKKFMELVVLPNISNEADRARAQDELPQSAAGKTIMTTEPKFVPNQA 80
gi 28203271   1 MENFDIYKDIAERTQGDIYVGVVGPVRTGKSTFIKKFMELMVIPNIDNEYKKKRAQDELPQSSSGKSIHTTEPKFVPNEA 80
gi 77994883   1 MERVDLFRDIAQRTSGNIYISAVGPVRTGKSTLIKKFMELLILPNIKNVYDRERAKDELPQSGAGRTIMTTEPKFIPNEA 80
gi 20516622   1 MEGYDIYRDIAERTQGDIYIGVVGPVRTGKSTFIKRFMDILVLPNLEEAPLKERIRDELPQSAAGKTVMTTEPKFVPEKA 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 464794    81 MSVHVSDGLDVNIRLVDCVGYTVPGAKGYEDENGPRMINTPWYEEPIPFHEAAEIGTRKVIQEHSTIGVVITTDGTIGDI 160
gi 28203271  81 VEINLNEGTKFKVRMVDCVGYIVKGAQGHMEEGKAKMVSTPWYDYEIPFEEAAEIGTKKVINEHSTIGILVTTDGTIADI 160
gi 77994883  81 IEININSSVKANVRLVDVVGYPVLGALGYEEEDGPRMVLTPWFDEEIPFAEAAEIGTRKVITDHSTMAFLVTTDGSITDI 160
gi 20516622  81 VEITINENTKFKVRLVDCVGYMVKGALGYMEGDKPRMVSTPWYDYEIPFEEAAEIGTRKVISDHSTIGLVVTTDGSITEI 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 464794   161 ARSDYIEAEERVIEELKEVGKPFIMVINSVRPYHPETEAMRQDLSEKYDIPVLAMSVESMRESDVLSVLREALYEFPVLE 240
gi 28203271 161 NREDYVETEERVVEELKEINKPFIILLNSRNPLSPETIELRKEMEEKYDVPVQIMDILNMKEQDIISVFSRVLKEFPIQE 240
gi 77994883 161 PRENYLAAEERVVEELKQLEKPFIIVLNSTHPNAPETKALAEELEQKYDVTVVPVDVAEIGINDLNALLENLLYEFPLVD 240
gi 20516622 161 PRENYVPAEERVIKELKELNKPFIILLNTTHPQNTETMNLASELEKKYDTPVIVVNVMQMEIKDIYKILEKVLFEFPIRE 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 464794   241 VNVNLPSWVMVLKENHWLRESYQESVKETVKDIKRLRDVDRVVGQFSEFEFIESAGLAGIELGQGVAEIDLYAPDHLYDQ 320
gi 28203271 241 INIDMPGWIEKLDRSHWLKLNFINLVKDMSKNVYKVRDVAKVVEEIKEAEFLEKSILDEMNMGEGTARVVLSPKNGLFYK 320
gi 77994883 241 VNFNLPQWIEELDATHWLKEKFTSAVHEALKNVKKVKDINNAVARLSENEYVDNVELENLDMGTGQASIKVAAKEGLFYR 320
gi 20516622 241 IAIDLPTWVDALDKNHWFKENVLSTVKESVKDLYRLRDISNLVGGLKANENFSEVFIKKIAPGEGSANIEIKTHEGLFFK 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 464794   321 ILKEVVGVEIRGRDHLLELMQDFAHAKTEYDQVSDALKMVKQTGYGIAAPALADMSLDEPEIIRQGSRFGVRLKAVAPSI 400
gi 28203271 321 ILGEICNREIEDENHLMDIMKDMNKAKLEYDKIEGALVDVKELGYGLVAPELSEMKLEEPEIVKQGNRYGVKLKASAPSL 400
gi 77994883 321 VLEEVSGYAIRGEHELLRLMRELSYAKKEYDKVAIALKEVKETGYGVVTPRLEEMNLEEPELIRQGNRFGVRLRASAPSM 400
gi 20516622 321 ILSDESGLTIKNDKELMSVIKELAHAKRQYDRIKEAFLKAQETGVGVVPASLEEMKFEKPEIVRQGGRFAVRLKASAPSY 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 464794   401 HMIKVDVESEFAPIIGTEKQSEELVRYLMQDFEDDPLSIWNSDIFGRSLSSIVREGIQAKLSLMPENARYKLKETLERII 480
gi 28203271 401 HFIKADIETEISPIMGTERESEELVKNLLEQFESDPSKIWESNMFGKSLEVLVKEGLQSKLYKMPEDVQVKIQKTLQKII 480
gi 77994883 401 HIIRADITTEITPIIGTEKQCEELVQYMLKEFEENPKKIWESEIFGKSLHDLVREGIQNKLHRMPENAQVKLQETLQRIV 480
gi 20516622 401 HIFRTDITAEVTPVVGTEKQSEDFVKYITEQFENAPEKIWESNIFGKTLSDLVKEGMQNKVSAIPENLSHKLRDTLEKVV 480
                       490
                ....*....|..
gi 464794   481 NEGSGGLIAIIL 492
gi 28203271 481 NEGNGGLICIIL 492
gi 77994883 481 NDGGGGLICIII 492
gi 20516622 481 NDSGGGIIFIII 492
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap