Conserved Protein Domain Family
spore_V_AC

?
TIGR02838: spore_V_AC 
stage V sporulation protein AC
This model describes stage V sporulation protein AC, a paralog of stage V sporulation protein AE. Both are proteins found to present in a species if and only if that species is one of the Firmicutes capable of endospore formation, as of the time of the publication of the genome of Carboxydothermus hydrogenoformans. Mutants in spoVAC have a stage V sproulation defect. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131885
View PSSM: TIGR02838
Aligned: 10 rows
Threshold Bit Score: 194.443
Threshold Setting Gi: 18145711
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22777063  14 QQYQDFQEKREVKRPILKNCIKAFLIGGLICFIGQIISTFYIYQFQFTEQTVGNPTTATLIFITMLLTGFGVYDRIGQFA 93
gi 10174185  14 QQYQDLAQKYELQRPVFKNCIRAFFIGGLISLIGQLLMTFFMTYFDFTEKTAGDPTIAVLIFLSALLTGLGVYDRMAQYA 93
gi 49330416   8 DDYVNKVKEYHPKPNYFINCVKAFFVGGLICTIGEVLMKFYIHYFHFSEQEAGNPTVATLVLLSAILTGCGVYDKIGQFA 87
gi 15025311  10 TDFNNLAKAAKPKPNTVKNCLSAFIVGGIICDVGQLVSDIFSRYG-VAKSDLSMYTSTMLIFIGAFLTGIGIYDKIANIA 88
gi 18145711  10 TKFDQLEQQIRPKPKLLRNCIMAFIVGGLICVIGQFVRNTFLYYG-FTEEQVSSLTPMTMVFLGALLTGLGLYDRIAAKA 88
gi 20516323   9 QEYKNIAQKYEPKPTLLKNVVMAFIVGGLISDIGQFFLNFYLSKG-FSMEDANTLVAITMVFIGAFLTGIGVYDDIGKFA 87
gi 77995313   6 NEYQKTVEKIKPKPPVLKNCLLAFLMGGFVCLLGEVLFHFLRGYG-ISEKDGYTVVSVVFILISAILTGTGIYDDLVRIF 84
gi 51855029  14 SLYRRMVARAEPSPPRLRNAVMAFVSGGLVCALGEGITDFWERVLRISHKQAADPTVATLIFLSSLLTGLGYFDKLARHA 93
gi 10174156   7 KQYQANIKLYQPKPNYGKNAVRAFLIGGFICLLGEAISDLYLMWFPLSERTVTAPMMATMILLAALFTGVGLYDKLGQFG 86
gi 56909804  13 EEYKENIVLYKPKSRYLKHGSLAFFSGGLICVIGQLIFRGYHALFQLSDETATSYMLITLIAIAVLATGMGFYRKGAQLF 92
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 22777063  94 GAGSAVPVSGFGNAVISAAIEHRTEGFILGVGGNMLKLAGPVIVYGVFSAFVVALIKTILI 154
gi 10174185  94 GAGTAVPVTGFANSIASAAIEHRTEGYVLGVGSNMFKVAGSVIVFGTFAAFIIGIIHTLVT 154
gi 49330416  88 GAGSAVPVTGFANSMASAALEHKSEGIVLGVATNMFKLAGSVIVFGVVGAYIIGLIRYTFK 148
gi 15025311  89 GAGSIVPITGFANSIVAPAIEFKKEGFVFGVSAKMFTIAGPVLVYGLSSSVIVGVIYYLIN 149
gi 18145711  89 GAGTIVPITGFSNAMVSPAIEFKKEGFVMGVGAKMFTIAGPVLVYGTGTSVIVGLIYYLLL 149
gi 20516323  88 GAGSIVPITGFANSIVSPAMEFKREGFVFGAAAKMFTIAGPVIVYGVSTSILIGIIYYFLK 148
gi 77995313  85 GAGLIVPITGFANSMVSPALEHKQEGLVLGVGAKLFTVAGPVIIYGVLSSLIVAIILRGLG 145
gi 51855029  94 GAGLAVPVTGFANAMTATALEFKREGLVFGIGGRMFQLAGAVIVYGVVTAFAVGIITGIAR 154
gi 10174156  87 GAGALVPVTGFTNAMASAALEHRSEGLVHGVATNMFKMVGAVIVFGVVVSYLVGLTRLLVQ 147
gi 56909804  93 GAGLLVPITGFANAMAATALEHRTEGLLTGVGSNLFRLIGPVLVFGISTAYLVSFSRLLIR 153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap