Conserved Protein Domain Family
spore_V_AE

?
TIGR02839: spore_V_AE 
stage V sporulation protein AE
This model describes stage V sporulation protein AE, a paralog of stage V sporulation protein AC. Both are proteins found to present in a species if and only if that species is one of the Firmicutes capable of endospore formation, as of the time of the publication of the genome of Carboxydothermus hydrogenoformans. Mutants in spoVAE have a stage V sproulation defect. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131886
View PSSM: TIGR02839
Aligned: 9 rows
Threshold Bit Score: 131.326
Threshold Setting Gi: 77997119
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 77997119   3 FLLSFLVGGVICVIGQLMMDLTsfRVTPAHVLVSFVTAGALISGFGVYEKLVELAGTGATLPLTGFGHLLTQGAIEGFKQ 82
gi 10174158   3 YIIAFTVGGLICIVGQVLLDVA--KMTPTQVLSTLVVAGAVLDGFHLYDRLIDFAGAGATIPITSFGHSLVHGAMAEGER 80
gi 56909806   3 FLWAFLVGGAICLIGQVLLDAA--KLTPVQMLVVMAIVGIVLDGFHLYEHLVELAGAGATVPLTGFGYSLVHGAMEEGAK 80
gi 29897710   3 FIYAFLVGGVICLIGQLLLDFV--KLTPAHLMATFVVIGAILDGFGLYDKLIKFAGAGATVPITSFGHSLLHGAMHAAEK 80
gi 56909835   3 FLWAFLVGGVICVIGQLLMDVG--KLTPAHTMSTLVVSGAILSGFGLYEPLIDFAGAGVTVPITSFGNSLVQGALMEANR 80
gi 15025309   4 YIASFLVGGAMCVIVQILMDKF--SITPAMILVSLVTLGVILGALDIYDILVKYGKAGATVPLPGFGYSLAKSTIAEVDK 81
gi 28204286   5 YIMAFLVGGAICVVAQIIINKT--KFTPARILVTFVTVGVILGALNIYDVVVKVGKAGATVPLPGFGFNLAKSTIKEVDQ 82
gi 20516325   3 YIRAFLMGGLICAIAQILIDKT--KLTPARILVTYVTLGAILGGIGVYKKLIDIGGAGATIPLLGFGNSLAQGVIKAVEK 80
gi 1304005    3 YLLAFVCGGAICIVGQLLLDIF--KLTPAHVMTSFVVIGAILDGFGIYDKFIEFAGGGAIVPIVSFGHSLLHGAMHQAHI 80
                        90       100       110
                ....*....|....*....|....*....|....*.
gi 77997119  83 KGILGLLGGGIANTATGISVAIIAGYIIALIFKPKG 118
gi 10174158  81 SGFLGVGMGIFEITSAGISSAILFSFLVAVVFKPRG 116
gi 56909806  81 -GLFKITDGVFEIASTTIVFSILFSVAAALFFKPRG 115
gi 29897710  81 HGYLGIGIGMFSLTSAGISAAILCSFFIALICKPKG 116
gi 56909835  81 VGLIGIITGIFEVTSAGISAAIIFGFLASLCFKPKG 116
gi 15025309  82 KGLIGAFTGGIKGTAAGITGAVFFGYLMALLFNSKT 117
gi 28204286  83 KGFIGIFTGGVTGSAGGITAAIVFGYLMAVIFNAKT 118
gi 20516325  81 DGLIGAFTGGLTATAGGISAAIFFGYIFALMFNPKT 116
gi 1304005   81 HGFIGIGMGIFELTSAGISAAILFAFIVAVIFKAER 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap