1FFT


Conserved Protein Domain Family
CyoC

?
TIGR02842: CyoC 
Click on image for an interactive view with Cn3D
cytochrome o ubiquinol oxidase, subunit III
Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131889
View PSSM: TIGR02842
Aligned: 17 rows
Threshold Bit Score: 216.739
Threshold Setting Gi: 46395811
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FFT_C        25 KIFGFWIYLMSDCILFSILFATYAVLVNGTAGG-PTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLA 103
gi 56603929   21 NVFGFWIYIMSDCVLFATLFATFAVFHKHTFGG-PGAQELFSLPYVFVETMLLLISSFTFGLAMLNRNSENINHVIKFLW 99
gi 29541615   18 DVFGFWLYIMTDCILFASLFATFLVLHHPGAVG-PPLKPLIDLPYVLVETFFLLASNFTFCLAIFGINKNKLPAVIFWLI 96
gi 33567893   32 TLLGFWVYLMSDCLVFACLFATYGVVGRNYDGG-PTGAELFDLPLVAVNTSLLLLSSITYGFAMLEMRRQRIGATQAWLA 110
gi 46400466   32 TYFGFWMYLMTDCLLFATLFCTYAVLHKSTFGG-PSSHELFQLPTAFIETLILLLSSMTCGLSMLAAVKSQKKYVIGWLI 110
gi 25166104   25 KILGFWVYLMSDCILFATLFATYFVLKDNVANG-PSGKEIFEIPLVFLETIILLSSSMTCSIASFSIKKNNKIKTNIWLF 103
gi 33504053   16 TIFGFWLYIMSDCILFASLFAMHAVLSTNFQKDlLISNNIFKLTFVFTETILLLLSSITCSTSMIYANITNPKKTLQWMI 95
gi 71796130   16 TIFGFWLYIMSDCILFASLFAIYSVLCNNTADC-SSGKDIFSLPFVFIETCCLLLSSLTHCKVMIYVEKSCTKQINIWMG 94
gi 46395811   15 ELLGFWLYLMSDCIIFCTLFSVYFILVDNVAQG-PSGHNIFQNNLIIIETFLLLFSSFSCNLVLFEMKNKNLYMVFLWLG 93
gi 499839718  24 KILGFWIYLMSDCILFAMLFATYVVLSHSIAGG-PSGKEIFELPAVQFETFCLLLSSLTYGIAILAMYRKQNNSVILWLF 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1FFT_C       104 LTWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCLSLF 183
gi 56603929  100 ITFFLGLGFIIMEVHEFYELAIEGHTWSSSAFLSSFFTLVGTHGLHVSMGLIWIVSMIFQLKKYGMNPMAKTKLTYLSLF 179
gi 29541615   97 LTFILGAGFVVMEVMEFIHLNAEGYSWHVSGAASAFFTLVGTHGFHVTMGLLWILIMIIQLPILKINKNTARRMVYLGLF 176
gi 33567893  111 VTGLLGAGFLGLELYEFAHLIHQGAGPQRSAFLSAFFTLVGTHGLHVTFGIVWLVTLMVQVSRHGLIPENRRRLMCLSMF 190
gi 46400466  111 ITFCLGSSFLFLEIQEFSLLIREGNGFDRSAFLSSFFTLVGTHGLHITFGLLWMIVMIAQVIYQGITLSTFRRLALFSLF 190
gi 25166104  104 ITVILGIIFINIEISEFYSLICKNYGPDRSAFLSIFFTIVGTHGVHVISGIIWMIVIMIQIYFYGCDKINKIRLKLLSLF 183
gi 33504053   96 LTLLLGLGFISMEIYEFHHLIANKYNPSRNAFFSSFFVLIGTHGIHVITGLIWIIIMTIHLIMTGLTQQNLIRLHCFSLF 175
gi 71796130   95 ITFLLGLCFISMEIYEFYHLIKLGNNPCRSAFLSSFFTLVGTHGLHVMAGLIWIAVMIIHIVYQGLTYTNYIRMQCLSLF 174
gi 46395811   94 ITFLLGLLFVFLELFEFFHLINLGFGPTRSGFLSSFFVLIATHGIHVISGLIWIIVMIKYVYTFNITNLIYYRMLCLNLF 173
gi 499839718 103 CTFILGLGFIIVEIMEFYNLIINGFGPNRSAFLSGFFSLVATHGCHVISGLIWIMVMIVHVYKKGLTLDNQIRLQCLSLF 182
                        170       180
                 ....*....|....*....|.
1FFT_C       184 WHFLDVVWICVFTVVYLMGAM 204
gi 56603929  180 WHFLDIVWIFVFSIVYLLGAV 200
gi 29541615  177 WNFLDIVWIFLFTIVYLMGAV 197
gi 33567893  191 WHFLDLIWVGVFTFVYLMGVL 211
gi 46400466  191 WHFLDLIWISIFTFVYLLGVA 211
gi 25166104  184 WYFLEIIWIFVFNVIYLLGII 204
gi 33504053  176 WHFLDIIWICVFTEVYLIGVL 196
gi 71796130  175 WHFLDVIWICVFTEVYLLGVL 195
gi 46395811  174 WHFLDIVWVFIFSFVYLFGMV 194
gi 499839718 183 WHFLDIIWICVFTVVYLLGVL 203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap