Conserved Protein Domain Family
spore_sigmaK

?
TIGR02846: spore_sigmaK 
RNA polymerase sigma-K factor
The sporulation-specific transcription factor sigma-K (also called sigma-27) is expressed in the mother cell compartment of endospore-forming bacteria such as Bacillus subtilis. Like its close homolog sigma-E (sigma-29) (see TIGR02835), also specific to the mother cell compartment, it must be activated by a proteolytic cleavage. Note that in Bacillus subtilis (and apparently also Clostridium tetani), but not in other endospore forming species such as Bacillus anthracis, the sigK gene is generated by a non-germline (mother cell only) chromosomal rearrangement that recombines coding regions for the N-terminal and C-terminal regions of sigma-K. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131893
View PSSM: TIGR02846
Aligned: 8 rows
Threshold Bit Score: 392.93
Threshold Setting Gi: 18145431
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18145431    3 MLQYLLE-LVGSKIFLTGYVTGNsTFPKPLNEKEEKIYLERLKDGDVEAKRVLVERNLRLVAHIVKKYSSnyqNSKEMDD 81
gi 56380912    3 GIFTAFTfLLKELTFLVSYIKNN-AFPQPLSAQEEEKYLALMAKGDEQARNRLIEHNLRLVAHIVKKFEN---TGEEVED 78
gi 22777683    3 GILSVLGlIIKEALFFVSYVKNH-SFPQPLPPDKESKYLQLMQEGDEVARNKLIEHNLRLVAHIVKKFEN---TGEDMED 78
gi 528974      3 VMYCLFN-IVGSITFFVAYIGNGaSFPQPLSESEEKYYLKKLKEGDPLAKNILIERNLRLVAHIVKKYSY---SGKEVDD 78
gi 20516259    4 VIAALVGtIVKEILNL-GYLTNTnSFPSPLSPEEERKYLEAYRRGDEEARNILIERNLRLVAHVVKKYSG---TGRDLDD 79
gi 77997226    3 VLGALITlVVEGLLFLLGYLAGS-AFPQPLSEEEEAYYIDRLLQGDREARDVLAERNLRLVAHIVKKFEG---TGEATED 78
gi 51856785    4 MLGPLAEaIVRSMLLLAGFVANSgTFPQPLSEEEEAKYLSRLQNGDEEARAVLIERNLRLVAHIVKKFDN---TGEDVDD 80
gi 500994413   3 FLSYLWD-VLGSALFLTGYVTGNtSFPKPLSDEEEKYYLDRLKKGDALAKDILVERNLRLVAHIVKKYSY---PGKDIDD 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18145431   82 LISIGTIGLIKAIDSFDTNKGIRLATYAAKCIDNEILMFFRNTKKTKGEVFLQDPIGVDKEGNEICLIDILSSDSDSVLE 161
gi 56380912   79 LISIGTIGLIKAIESYSPGKGTKLATYAARCIENEILMHLRSLKKTRKDVSLHEPIGQDKEGNEISLLDILKAEGEDIAD 158
gi 22777683   79 LISIGTIGLIKGVESFSTDKGTKLATYAARCIENEILMHLRALKKVKKDVSLHDPIGQDKEGNEISLIDILEAENENVIE 158
gi 528974     79 LISIGTIGLIKAIDSYNVSKGTRLATYAARCIENEILMLIRNNKKSKNEVYLQDPIGVDKEGNEISLIDILSSDDDSVIE 158
gi 20516259   80 LISIGTIGLIKAIDTYDFEKGTHLATYAAKCIENEILMSIRAEKKMKGEVFLQDPIGVDKEGNEISLMDVLGTDEDEVSE 159
gi 77997226   79 LISIGTIGLIKAIDTFRPDKGTKLATYAAKCVENEILMHLRATKKNRGEVSLYDPIGFDKEGNEITLLDILGTRGDIVLE 158
gi 51856785   81 LISIGTVGLIKAIGTFKPERGTRLATYAARCIENEILMHLRSLKRVRGEVSLYDPIGVDREGNEITLIDVLGSDPDVVPD 160
gi 500994413  79 LISIGTVGLIKAIDSFDNSKGTRLATYAARCIENEILMLIRNNKKTKGEVYLQDPIGVDKEGNEISLMDILSSDEDSIIE 158
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 18145431  162 AVENSLQVKELYKKMsDVLSPREKEIIQMRYGLLDGDIKTQREIAGILGISRSYVSRIEKKALKKLNKEFK 232
gi 56380912  159 EIHLNMELEQVKQYI-SVLDEREKEVIINRFGLGRQREKTQREIAKELGISRSYVSRIEKRALMKMFHEFY 228
gi 22777683  159 YIQLNMEISKMQKYF-SVLDKREREVIVYRYGLNDREEMTQREIAKKLNISRSYVSRIEKRALMKVFHEYY 228
gi 528974    159 IVENRIQIGKLYVEInRVLKGREKAIIKMRYGLGDGKPRNQREIAQILGISRSYVSRIEKRALKKLYRQLN 229
gi 20516259  160 QVEKKIQIKKLYSKLnSVLKNRERMIIEMRYGLYNGRVRTQREIAKMLGISRSYVSRIEKKALNKLYKELS 230
gi 77997226  159 QVVRMLDAETIEKNL-KKLTPRERKVIEERFGLSQTPRKTQREIAKKMGISRSYVSRIEKRAILKLLNCFP 228
gi 51856785  161 LVGKRLDESKLREKL-KKLGGKERQVLELRYGIAGGPRKTQREIARMLGISRSYVSRIEKKAVMKLCRELF 230
gi 500994413 159 IVSTKIEVKKLYGKIdTCLRGREKKVIQMRYGLKDGRPRTQREIAGILNISRSYVSRIEKKALKKLYKELN 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap