Conserved Protein Domain Family
spore_III_AC

?
TIGR02848: spore_III_AC 
stage III sporulation protein AC
Members of this protein family are designated SpoIIIAC, part of the spoIIIA operon of sporulation genes whose mutant phenotype is linked to sporulation stage III. Members of this family are encoded by the genome of a species if and only if that species is capable of endospore formation, as in Bacillus subtilis. The molecular function of this small, probable integral membrane protein is unknown. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131895
View PSSM: TIGR02848
Aligned: 7 rows
Threshold Bit Score: 56.1764
Threshold Setting Gi: 51856687
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60
               ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 20516287  1 MNIDIIFKIAAIGILVTVLNQILIRSGREEQAMMVTLAGIVVVLMMVIHLINNLFNTVKTIFHL 64
gi 15025080  2 LDISLLFKIAGVGILTIIIDKILKSSGKDDFAVVTNLAGIVILLLMVISLISKLFEAVKTMFQL 65
gi 77996045  2 ASIEIIFKIAGVGILTAVIHTVLKHAGKEEQAYMATLAGISIVLFWVIQILAELFTEIKTVFKL 65
gi 1710822   3 VDVNVIFQIAGVGIVVAFLHTILDQMGKKEYAQWVTLLGFIYILFMVATIVDDLFKKIKAVFLF 66
gi 51974775  3 IDVGLIFQIAGIGIVLAFIHTVLKELKREDIANWVILVGFVVILFHVAFLINTLFDKIKSVFLF 66
gi 22777576  3 LDATILFQIAGIGIIVALIHTILKQMGKEEIAQFATLIGFIIVLVIVVNGLSDLFQQIKSVFLF 66
gi 51856687  4 VDVQLLFRIAGVGIIVAVMATVLKQAGKDEQGQMVTLVGVLVVLMMVVTLLGRFFNLVKATFGM 67
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap