Conserved Protein Domain Family
spore_dpaA

?
TIGR02853: spore_dpaA 
dipicolinic acid synthetase, A subunit
This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium. The B subunit is represented by TIGR02852. This protein is also known as SpoVFA. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131900
View PSSM: TIGR02853
Aligned: 6 rows
Threshold Bit Score: 446.462
Threshold Setting Gi: 51856372
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22777291   2 NRLIAVIGGDARYLELIKQLKNVpNNKLLLCGFDkLEQGFTGLNELELDELDPSTLDVVILPITGTDQHGKVETVFTDKE 81
gi 51856372   5 GKIIAVIGGDRRMAEAVHFLLRA-GARVRIAGLE-WEDRFAGVEVCTSGADALTGAQVVILPVQGVSPDGTVYTEGDVPP 82
gi 77995672   7 GINLTILGGDLRNVYLIDELEKL-GAFIKVLGLP--VARRSKVVLCHSLEEALKDTDVVVLPMPGVNHQGKLFAPLCEES 83
gi 52003491   4 GLTIAIIGGDARQLEIIRKLTEQ-DAKVFLIGFDqLDHGFTGATKLKLNELDFGTIDSIILPVSGTSMEGTVATVFSNEK 82
gi 47504378   4 EMHIAVIGGDARQLEVIRKLVEL-DAKLSLIGFDqLDHGFTGAAKESIQNLDFTSLDAIILPVAGTNAKGEVDTIFSNEK 82
gi 56910226   4 GTHVVMIGGDARQLEIIRKLSAL-DAKISLVGFEqLNDGFIGASKQELPDIEWSTVDAILLPVGGMSNDGLIASVFSNQQ 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22777291  82 ISLGPDWFQQLKKSCVVFTGITNDYLTEQTKNAGVTLISLLERDDVAIYNSIPTAEGAIMMAFEQTDQTIHSSRVMVVGF 161
gi 51856372  83 CVIDLDGLRRVARGAPVFVGLSNPHLNRLCEEAGLPLIEYREADHFATWNSIPSAEGAIQMAMESTPFTIFGSRSLVLGF 162
gi 77995672  84 YYLTPELKDSIKGEVLFVVGFANSYLKQLAADLGVELVEIAEMDHVAIYNSIPSAEGAIQMAMEMIPITIHGSNAFVIGF 163
gi 52003491  83 VVLKQEHLEKTKPHCAIYSGISNQYLDGMAKGANRRLIKLFERDDIAIYNSIPTVEGAIMMAIQHTDFTIHGSNVMVLGL 162
gi 47504378  83 VSITKEQIENTPEHFTIYSGIGTPYLENLVSTTNRKLIKLFDRDDVAIYNSIPTVEGTLMMVIQHTDYTIHGSNVMVLGF 162
gi 56910226  83 LKLKAAYLNETPDHCTIYTGISTDRLEKLAAKAKCKIVLLMDRDDVAIYNSIPTAEGAVMLAIQHTDHTIHHAKVAVLGL 162
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22777291 162 GRVGNTVANKFSALGAKVSVCARSIRDLARITEMGLHAIPLNKMSEYTAECDILINTIPALVVTKESIQHLPTNAVIIDL 241
gi 51856372 163 GRTGRAIAMLLRGLMSDVSVAARSELDQARIWAAGHRPVEWPKLADAVAEADIIFNTVPALVLTRDILSRAPRHAVIIDV 242
gi 77995672 164 GRTGQTLARMLAGIGARVFVAARKPKDLARIYEQCYIPVTFKELEVKIVEADIVFNTVPALVLPANLLQKLKKDAVIIDL 243
gi 52003491 163 GRTGMSISRTFSALGARVKVGARDSAHLARIMEMGLTPFHTNELAEHVENIDICINTIPSLILDKHVLSRMTPRTLILDL 242
gi 47504378 163 GRTGMSVARAFQSLGAHVKVGARRSEHIARITEMMFSPFHMQNIEKEVGNIDIVINTIPHLVVTANVISKMPAHTLVIDL 242
gi 56910226 163 GRIGMTIARTFHALGASVFVGAKETALLARAFELGVEPFPLTALKETLKNIDLVINTIPARIVTSDVLAELPQHAFVLDL 242
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 22777291 242 ASKPGGTDFTYAKRRGINAILARSLPGIVAPRTAGKILAdvvnQILDE 289
gi 51856372 243 ASAPGGTDFEAARELGLTARLAPGLPGIVAPVTAGRIIA----ELVVR 286
gi 77995672 244 ASNPGGVDFEAAKSLGIQAVLAPGLPGKVAPKTAGKLLAkvlpELILK 291
gi 52003491 243 ATRPGGTDFDFAEKQGIKALLAPGLPGIVAPKTAGQIIAnvlcNLLSE 290
gi 47504378 243 ASKPGGTDFRYAEKRGVKALLAPGLPGIVAPKTAGQILAnvlsQLLAE 290
gi 56910226 243 ASKPGGVDFAYAKKRGLKAMLVPGLPGMVAPKTAGKILAnvlsDLLHE 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap