Conserved Protein Domain Family
spore_II_GA

?
TIGR02854: spore_II_GA 
sigma-E processing peptidase SpoIIGA
Members of this protein family are the stage II sporulation protein SpoIIGA. This protein acts as an activating protease for Sigma-E, one of several specialized sigma factors of the sporulation process in Bacillus subtilis and related endospore-forming bacteria. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131901
View PSSM: TIGR02854
Aligned: 10 rows
Threshold Bit Score: 204.512
Threshold Setting Gi: 51856047
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22777157   1 MTIYLDAVWMLNFLIDLMLLMLVKLLARDSVNLLRLLFGALIASLIVPITIF-----------------YPESFINGAVG 63
gi 49330651   4 LVVYADVVWLLNACIDFLLLLLTATVLKKKIKRWRLVLGAFIGSTIVIFAFT-----------------PFASMMTHPIM 66
gi 10175177   1 MTLYADVIWLLNLCIDYLLIALTAILLKRPFQQFRFICASFVASLIVVFMFT-----------------PVADFFLQPIV 63
gi 56910360   1 MTVYLDLIWLLNAGIDYLLLAATALLLKRRFSQWRLVLAALFASLIVFLMFT-----------------PAAPLFLNPVI 63
gi 20516646  12 KLMYLDILFLENLLINYVILSLTQRFSRKYSTPFKLLLGAFIGAGYVLIFFL-----------------TPYSFFREFLA 74
gi 2499889    1 MVIYLDVLIFENSIVNTFLLYITAQTLRIKVKMRYLILAGIFGGLYVIVLVI-----------------PTLKIFSSLIF 63
gi 28203258   1 MHIYLDILFLENFIINRFLLSLTAKTVKEKVNSIFLSLASIIGSSYLLFILI-----------------GKKTYANNIFF 63
gi 18145426   1 MTVYIDIVILENFLINFFLLYLTLQTLKDTIIYKRIILAAFLGAIYTLFVFV-----------------PGLNILTSLPL 63
gi 77996395   2 PVYFLESVFLGNFILSYAALIFAAKVLNLKLSFAKNLFFSLVGAVMAEIYLA---------------------WPYFGIK 60
gi 51856047   5 PAVRPDVFFLVNFGLDLALLWFAARAARVRYRAWRLWVAALLGAALAVLPVLlpdvpaaapaspsagpaPKAGWLFSGAA 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22777157  64 KLLYSVLIIFSAFGWKGTYQTLKLCLLFYFVSFAIGGGLTAIHFMLSSPVsMTANGMItfnkgfGDPISWLFILIGFPII 143
gi 49330651  67 KLLYSLLIVYTAFGFTTFRNYTQTVFTFYFVTFMVGGGLMGTHFFLQTNE-MVNGLVQsqsisyGDPISWLFVIFGFPVI 145
gi 10175177  64 KGLYSALIVWIAFGYQRWRFFLQALFMFYFVTFMTGGGLFALHYFWQTEIpFLTDHSLtsg-sfGSGISWLFVCLGFPLV 142
gi 56910360  64 KLIYSGLIVFIAFGYKRFSFFLQNLASFYFVTFVTGGGLFAMHYFFETNVdVLAFLPGhg--vgGSMVSWAFVLIGFPLA 141
gi 20516646  75 KFLLSLLIIYMAFSPETLKEFFRILSVFYLVSFAMGGTIFALLYAVKGREtALPVG------------------IGFAAL 136
gi 2499889   64 KIIAAFLMIIICFRKKSLRFNIKALAVLIMYSMVTAG--LCFFIELNNTRgSYFNAFI-------GNVSYKWILIAIMII 134
gi 28203258  64 KLLVAFCMVFTIFRKKNIIFKLKTTFIFILYSILLAG--ICIFMQIANGNgLKSNVAI-------VNFPYKKLLMAIILL 134
gi 18145426  64 KLLFSFGMITIISERRELKTIIKRYITFLVITFAFCG--TCFMFALVENQyNISESFI------INDYSTKSIIFSLIIS 135
gi 77996395  61 ILAFCVFFLSTYLLTKSPSSAGKLFLLTLASFFFLNGAYHALIF---------------------TGYYPEFFLLAALIL 119
gi 51856047  85 LLAGSAALAWLLVWPGPWAQFAAVLGFFWTGLILSGG----LLFLLAERYpALFAAPPaalvagGAGVA----LAGAQLL 156
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22777157 144 WYFTKRRMDEHVGEQIKYDQMCEVFLTLNQKVQQSKGYIDSGNQLVDPLTKRPVIICDRTFLKEWFTEDEWLQLEKAKNN 223
gi 49330651 146 YYFSKKRIESVEVTKIHYDQIVKLKIQLAEEELELAGLIDSGNQLYDPLTKTPVMIMHISSLEHCLPAWLTEQIYSKTEI 225
gi 10175177 143 WYFSKQRLETIEVKKVQYERLVDVEVWLEQSKLTIRGIIDSGNQLQDPFTKAPVMIIQADVLRGQIPDEWIEQMLNVESI 222
gi 56910360 142 LYFCKQQFGAVKSKQFHASQLAEVEFWIEGISFSAPGLIDTGNRLRDPLTKMPVMVAEAALLYSAFGKQQVDALLELEAE 221
gi 20516646 137 LLFLN--WDYVVKKAKQDKMKYEIYIEIFGKKVKTYGFVDTGNKLFDPLSNLPVVVVAYSSVKSLLPYDLEEFVAEGKID 214
gi 2499889  135 YMFVNRIIWFINDRKLTQSLIYEIEICFKDNSKFINAFLDTGNELREPITNLPVIVVEKDMVSGIKWDDCPKF------- 207
gi 28203258 135 YLLLERIVSFIRDRIVLDKLIYKIDIDLKNSKKSINAFLDTGNELVEPVTNLPVIVVEKDIFQKNEIEDYDTV------- 207
gi 18145426 136 YILVSGVMNYFKNRAIINNFIYDLDVCIDSEVVNIKAFLDTGNGLVEPATALPVIIAEREKFRWVNIKEKDQF------- 208
gi 77996395 120 AFIGEYAYKQYQRIVRLKKYGFSLEIVYSGKKVTVQSFLDTGNRLYDPQLGWPVVVVEYRAVKKILPVDFFQS------- 192
gi 51856047 157 W-------QAYRERAEVDDGLYELEVRVDGRREVVEGLVDSGNLLRTPVGRMPVAVVEGGRLRSLLPPAVLEAASSGPMG 229
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 22777157 224 LDmd---eiPKRWQDKIQIIPYQGVDGGSSMMIGIRPERVIV--NYNDQQLLATNVIIGIQFGNLVRDDSYHCLLHPQIM 298
gi 49330651 226 PQip---enDSGWATKLRLIPFRAVGVENQFLWAIKPESVQI--YHEGSSIVVNKVLIGLNTQQLSTNGEYQCIVHPKML 300
gi 10175177 223 GTtd----gDERFMRRMSVIPYRVVGQPQRLLAVFKPDSVRI--RHEEEWMTVSKVLIGLNDKALSPEDTYQCIVHPKMI 296
gi 56910360 222 NE-------PSPLMKRVRLIPYRAVGQGSSYMAALKPDRVKI--RYQNEAYETNHVLIGLSRETLSPEQHYRCIVHPQIM 292
gi 20516646 215 FGkvleiikDEKWHSRIGIIPFSGVG-TKGLLLGIRPDRLII------NGKEIKDVMLGISTDKME-----FALLNPEIM 282
gi 2499889  208 ------------------YVPFRLFNGKAGNLEAFKPSYVKI---YIGDKVEVRNAIIALIDNKLSSLNDYNALLSRGSI 266
gi 28203258 208 ------------------YIPFSVVNGDRGMLKAIKPEMVSI---YKKREIEKKEVLIAFSDKKLSSSGDYRALLSRGII 266
gi 18145426 209 ------------------RIPYKVVDGNSGYMKGIKIDNIKL--CNVNGETMTRDAILCFCDNKLSKEGEYEALLSRGII 268
gi 77996395 193 --------------KTIRRIPFRGVGRGQGFFWGFIPDELKI--WQEGEVIRVKRAVVAITFQSLNSE--FQALLSEEIL 254
gi 51856047 230 LDg-----lPAEWQSRCQLVPFAAVGRSDGWLLVIRPDGLSVrpRGRGDWVQVEGR-VGLAAGPLDPEGRYAALLPTAMI 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap