Conserved Protein Domain Family
spore_sigH

?
TIGR02859: spore_sigH 
RNA polymerase sigma-H factor
Members of this protein family are RNA polymerase sigma-H factor for sporulation in endospore-forming bacteria. This protein is also called Sigma-30 and SigH. Although rather close homologs in Listeria score well against this model, Listeria does not form spores and the role of the related sigma factor in that genus is in doubt. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131906
View PSSM: TIGR02859
Aligned: 6 rows
Threshold Bit Score: 351.409
Threshold Setting Gi: 18146088
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42735089  13 FRDLEDEAIVELVRKGNTDALEYLIHKYKNFVRAKSRSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSSFKAFAELCI 92
gi 20517313  18 YEQMEEEEIVSRAQQGDELALEYLIERYKNFVKAKARTYFLVGADKEDIIQEGMIGLYKAIRDYKNNKLTSFKAFAELCV 97
gi 77996698  15 YDYMSDEEIVEWARAGDEQALEYIINKYKNFVRSKARAYFLIGADREDIIQEGMIGLYKAVRDFRPDKLSSFRAFAELCV 94
gi 22775781  14 LEQLDDTDLLQFIRQGNSHALDLLIQRYISFVRAKARTYFLVGADKEDIIQEGMIGLYKAIRDYDVDKLSSFKAFAELCV 93
gi 28204631  21 FKNMLDEEVVLEAKEGNTRAQEYLINKYKNFVKAKAKSYFLIGADREDIYQEGMIGLYKAIRDFRADRLASFKAFAELCI 100
gi 18146088  16 FKDLTDKEVVMLAKNGDNMAQEYVISKYEQFVKAKSKSYFLIGADKEDIYQEGMIGLYKAIRDFNPDKFASFKSFAELCV 95
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 42735089  93 TRQIITAIKTATRQKHIPLNSYVSLDKPIYDEESDRTLLDVISEAKVTDPEEMIISQEEYTDIESKISELLSDLERKVLS 172
gi 20517313  98 TRQIITAIKTATRQKHIPLNSYVSLNKPIFDEESDRTLMDVVSTQCIADPEELIISKEEYVNIENKMEELLSGLEWEVLV 177
gi 77996698  95 TRQIITAIKTATRQKHIPLNSYVSLNKPIYDEDSDRTLMDVLSGVKVADPEELIISREEFADIEGKMNEILSSLEWKVLI 174
gi 22775781  94 TRQIITAIKTATRQKHIPLNSYVSLDKPIYDEESDRTLLDIIGGSIDVDPQELLISQEDYGTLEHKLSKLLSDLEKKVLQ 173
gi 28204631 101 TRQIITAIKTATRQKHIPLNTYISLNKPIYDDESDRTLMDVLSEAKVSDPEELVISREEIGCIQNEMEEVLSALEMEVLM 180
gi 18146088  96 TRQIITAIKTATRQKHIPLNTYISLSKPIYEEESDRTLLDTVVGITITDPESLVIGKEEVEKIESAINSVLSELELEVLN 175
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 42735089 173 LYLDGRSYQEISEQLNRHVKSIDNALQRVKRKLERYME 210
gi 20517313 178 AYLDGKSYQEIAEDLNRHVKSIDNALQRVKRKLERYLE 215
gi 77996698 175 YYLEGKSYQEIACELNRHVKSIDNALQRVKRKLEKYLE 212
gi 22775781 174 LYLDGRTYQEISEHLNRHVKSIDNALQRVKRKLEQLME 211
gi 28204631 181 SYIDGKSYQEIACDLDRHAKSIDNALQRVKRKLEKFLN 218
gi 18146088 176 SYLDGKSYQEIACDLDREAKSIDNALQRVKRKLEKCLN 213
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap