Conserved Protein Domain Family
QoxB

?
TIGR02882: QoxB 
cytochrome aa3 quinol oxidase, subunit I
This family (QoxB) encodes subunit I of the aa3-type quinone oxidase, one of several bacterial terminal oxidases. This complex couples oxidation of reduced quinones with the reduction of molecular oxygen to water and the pumping of protons to form a proton gradient utilized for ATP production. aa3-type oxidases contain two heme a cofactors as well as copper atoms in the active site. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 131928
View PSSM: TIGR02882
Aligned: 3 rows
Threshold Bit Score: 1079.88
Threshold Setting Gi: 22777939
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56381835   2 KWSEFFV--TGEPLIYAADVAIVLTMVGIVFVLTYFKKWKWLWNEWLTTVDHKKIGVMYIICAVLMLFRGGVDALLMRAQ 79
gi 22777939   3 ILERFAIppHDDPMLYASLVAIALVSIAVVVGITYFKKWGYLWNEWLTTVDHKRIGIMYIISALLMLFRGGADGVMMRLQ 82
gi 57284439   4 PWDQLLV--KGNWMITMAQIGAPFLVIGLIAVITYFKLWKYLYKEWFTSVDHKKIGVMYLICAVLMFVRGGIDALLIRAQ 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56381835  80 LTAPNMKFLDAQHYNEIFTTHGTIMILFMAMPFIIGLMNIVVPLQIGARDVAFPYLNALSFWLFFFGAMLFNISFVIGGS 159
gi 22777939  83 TSVPDNSFLDAQHYNEVFTTHGVVMIFFMAMAFIIGLMNYVIPLQIGARDVAFPRLNALSFWLYFAGAMLFNISFVVGGS 162
gi 57284439  82 LTVPDNKFLESNHYNEIFSTHGVIMIIFMAMPFIFGLWNIVVPLQIGARDVAFPVLNNVSFWLFFAGMILFNLSFIIGGS 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56381835 160 PDAGWTAYFPLAGNEFSHGVGNNYYAVALQISGIGTLMTGINFLVTILKMRAPGMTLMRMPMFTWTILITCVLIIFAFPV 239
gi 22777939 163 PDAGWTNYYPLAGPEFSEHVGVNYYNWALQISGIGTLMTGINFVVTIMKMRAPGMKLMKMPMFTWSALITNIIIVFAFPV 242
gi 57284439 162 PAAGWTNYAPLAG-EFSPGPGVNYYLIAIQISGLGTLATGINFFVTILRCKTPTMKFMQMPMFTVTTFITTLIVILAFPP 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56381835 240 LTVALALMTFDRLFDTQFFTMANGGMSMLWANLFWIWGHPEVYIVILPAFGIFSEVVSTFAQKRLFGYKAMVGSIVGIAF 319
gi 22777939 243 LTIALLMGTLDRQFFTNFFTTSDGGMDMMWANLFWIWGHPEVYILILPAFGIYSQIISTFSQRNLYGYKSMVASMVIISL 322
gi 57284439 241 LTVALALMTTDRIFDTAFFTVAHGGMPMLWANFFWVWGHPEVYIVILPAFGIYSEIIPTFARKRLFGHQSMVWATAGIAF 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56381835 320 LSFIVWVHHFFTMGAGPAVNSAFSITTMAIAIPTGVKIFNWLFTLRKGKIRFTTAMLWSLAFIPNFVIGGVTGVMLAMAA 399
gi 22777939 323 LSFVVWVHHFFTMGQGALTNSIFSITTMAIAVPTGIKIFNWLLTMWKGKIRFTTPMLYSIAFIPLFTIGGVTGVMLSIAS 402
gi 57284439 321 LSFLVWVHHFFTMGNGALINSFFSISTMLIGIPTGVKLFNWLLTLYKGRITFESPMLFSLAFIPNFLLGGVTGVMLAMAS 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56381835 400 ADYQYHNSYFLIAHFHYVLIAGTVFACFAGLHYWYPKMFGHILNERLGKWTFWLFMIGFNICFFPMYFLGLMGMTRRMYT 479
gi 22777939 403 ADYQYHNTMFLVAHFHNVIIPGVVFAMIAGLIYYWPKMFGFLLNERIGKWAFWNIVIGFCLSFFPMYITGLDGQARRMYT 482
gi 57284439 401 ADYQYHNTYFLVAHFHYTLVTGVVFACLAGLIFWYPKMMGYKLNETLNKWCFWFFMIGFNVCFLPQFILGLDGMPRRLYT 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56381835 480 YSAGLGWTPLNVVATVGAVLMGIGFIVLCYNIYYSARYGERDMTGDPWN--GRTLEWATASP-PVHYNFPVTPVVEDVDA 556
gi 22777939 483 YSEASGFGPLNLLSFGGVALLTLGFILLVYNIYYSFRHAPRNVGDDPWN--ARSLEWATHNP-VPEYNFAVTPTVDSEEA 559
gi 57284439 481 YMPSDGWFLLNLISTIGALLMAIGFLFLVVSIVYSHFKSPREATGDNWDglGRTLEWTTASAiPPKYNFAITPDWNDYDT 560
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56381835 557 YWVMKKKYGGFQvkEEDLKPIHMPSNSGRPFWMSVAFFVAGFGLVFKWFALAIVGALFIVLGLILRSFEDDDGYYIPVDE 636
gi 22777939 560 FWDYKKNGYKLF--KEPISDIHMPNNSGWSIILAGFFFIFGFFFVFHVWAGVIVGAIGILGCLLYRTFEKDDGHHIHKEE 637
gi 57284439 561 FVDMKEHG-RHYldNHNYKDIHMPNNTPVGFWIGIFMTIGGFFLIFETVIPALICLFGIFGTMIYRSFQIDHGYHIPAAE 639

                ....*...
gi 56381835 637 IKRMEQAA 644
gi 22777939 638 IIETEKKF 645
gi 57284439 640 VAETEARL 647
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap