1W1B,2J13


Conserved Protein Domain Family
spore_pdaA

?
TIGR02884: spore_pdaA 
Click on image for an interactive view with Cn3D
delta-lactam-biosynthetic de-N-acetylase
Muramic delta-lactam is an unusual constituent of peptidoglycan, found only in bacterial spores in the peptidoglycan wall, or spore cortex. The proteins in this family are PdaA (yfjS), a member of a larger family of polysaccharide deacetylases, and are specificially involved in delta-lactam biosynthesis. PdaA acts immediately after CwlD, an N-acetylmuramoyl-L-alanine amidase and performs a de-N-acetylation. PdaA may also perform the following transpeptidation for lactam ring formation, as heterologous expression in E. coli of CwlD and PdaA together is sufficient for delta-lactam production. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131930
View PSSM: TIGR02884
Aligned: 10 rows
Threshold Bit Score: 388.293
Threshold Setting Gi: 15026067
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W1B_1       24 NWGFKRSVNHQPPDAGKQLNSLIEKYDAFYLGNTKEKTIYLTFDNGYENGYTPKVLDVLKKHRVTGTFFVTGHFVKDQPQ 103
gi 20517024  72 GWGLRVLPNHQTPEITPYAMELVKKYNAIFVGDTTKKVVYLTFDEGYEAGYTPRILDVLKENGVKAAFFVTGPYVKQQAD 151
gi 28204294  84 DWFFEPKKDGSPSTVPNDVENVIKNHSTYFLGDTSEKVIYLTFDEGYENGYTSKILDVLKANDVKAAFFVVTPYIKTNKD 163
gi 56378804  35 HWGFKRSENHEPPSAGKELDELLAKYDAFYLGDTSEKTIYLTFDNGYENGYTAQILDVLKEKHVPAAFFVTGHYLQTAPD 114
gi 49331663  32 NWGIPRPKNETVPDAGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGHYIKTQKD 111
gi 22776561  27 GWGYSKNSNHEIPDIGS-YQALLDKYNAYYVDDSGEKVLYLTFDNGYEQGYTDEILDVLKEEKVPATFFVTGHYVKSKPD 105
gi 56909307  30 NWSYKPAPAHTPADTEPMYKELLEKADGYFIGDRDSKSLYLTFDNGYENGYTEKVLDVLKEKQVTGAFFVTGHYLKTAPE 109
gi 18145531  38 NWYYSFNKEEGVPH-GPKETPYISNHKVVYCGDTSKKEIFLTFDEGYENGNTAKILDILKENQVPAAFFVTRPYIKDYPD 116
gi 15026067  67 EWYYMNKGKASEQGPPKETSEYVPKYNCYYIGDSSKKVIYLTFDEGYERGYTPKILDVLKKHKAKAAFFVVKPYITSSPE 146
2J13_A       19 NWGIPRPKNETVPDAGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGHYIKTQKD 98
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1W1B_1      104 LIKRMSDEGHIIGNHSFHHPDLTTK---TADQIQDELDSVNEEVYKITGKQdNLYLRPPRGVFSEYVLKETKRLGYQTVF 180
gi 20517024 152 LVKRMVEEGHIVGNHTVNHPSLPTL---PDEKVKEEILGLEKMFEDLTGQK-MKYFRPPRGEYSERTLYITKSLGYRTVF 227
gi 28204294 164 LIKRMVDEGHLVCNHSVHHPSMAQValkGKEKFKEEFTGVEEIFKEVTGKEmPKFFRPPMGKYSELSLAYTKELGYKTIF 243
gi 56378804 115 LVKRMAAEGHIIGNHSWHHPDLTAA---SEERFREELEKVKEKTEELTGQKgMAYLRPPRGIFSERTLSLARDLGYYHVF 191
gi 49331663 112 LLLRMKDEGHIIGNHSWSHPDFTAV---NDEKLREELTSVTEEIKKVTGQKeVKYVRPPRGVFSERTLALTKEMGYYNVF 188
gi 22776561 106 LIKRMVDEGHIIGNHSYHHPDFTIM---NKQAIQKEVEELEAAVAEVSDQKeMMYLRPPRGVFNEDTLKWSNELGLVHIF 182
gi 56909307 110 LVKRMVAEGHIVGNHSYHHPSLPQT---SDAKLAAELDDVKTLFTEITGETeMRYLRPPRGEFSERTLMKSKELGYTNVF 186
gi 18145531 117 LIKRMDEEGHLVCNHTSHHPSMAKIl--DKEKFTKEFTEVEEEYSKVTGKEmPKFFRPPMGKYSEQSLAYTEELGYTSVF 194
gi 15026067 147 IVKRMEKEGHYVCNHSVHHKSMPSIy--DEAKFKSELDGVEEEYKKVTGKEmPKYFRPPMGKYSELSLYYTQKLGYKTIF 224
2J13_A       99 LLLRMKDEGHIIGNHSWSHPDFTAV---NDEKLREELTSVTEEIKKVTGQKeVKYVRPPRGVFSERTLALTKEMGYYNVF 175
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
1W1B_1      181 WSVAFVDWKInNQKGKKYAYDHMIKQAHPGAIYLLHTVSRDNAEALDDAITDLKKQGYTFKSIDDLM 247
gi 20517024 228 WSLAMADWQP-LPGGPEESYSTVMKRLHPGAVILLHAVSKDNAQALDRIIKSIKEEGYEFKTLDDIP 293
gi 28204294 244 WSFAYNDWNVdKQPNPEAAKKRIVDKAHNGAIYLLHAVSKTNTEVLDSVIKELKDKGFRFASLEELK 310
gi 56378804 192 WSLAFVDWQTdRQRGWQYAYDQIMKQIHPGAILLLHSVSKDNAEALPKVIDDLRKQGYTFASLDELM 258
gi 49331663 189 WSLAFLDWKVdEQRGWQYAHNNVMTMIHPGSILLLHAISKDNAEALAKIIDDLREKGYHFKSLDDLV 255
gi 22776561 183 WSLAFMDWNTdGQKGWQYAHGQIMDQIHPGAIILLHAVSSDNAKALKQVVKDLKEQGYTFKSLDHLM 249
gi 56909307 187 WSLAYKDWEVdKQKGGKYAYDQVMKRIHPGAIMLIHAVSPDNAEALPDIIDECRRQGYTFRSLDELS 253
gi 18145531 195 WSFAYKDWLVdEQPSKEAAKKKILDKVHNGEVALLHAVSDTNTAILDEILKELKSNGYEFKSLNDLT 261
gi 15026067 225 WSFAYGDWEPdHQPGKAEAKKKILEKTHNGTVLLLHAVSKTNADVLDELLTHWEKEGYKIGTLDDLT 291
2J13_A      176 WSLAFLDWKVdEQRGWQYAHNNVMTMIHPGSILLLHAISKDNAEALAKIIDDLREKGYHFKSLDDLV 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap