Conserved Protein Domain Family
spore_sigF

?
TIGR02885: spore_sigF 
RNA polymerase sigma-F factor
Members of this protein family are the RNA polymerase sigma factor F. Sigma-F is specifically and universally a component of the Firmicutes lineage endospore formation program, and is expressed in the forespore to turn on expression of dozens of genes. It is closely homologous to sigma-G, which is also expressed in the forespore. [Transcription, Transcription factors, Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131931
View PSSM: TIGR02885
Aligned: 8 rows
Threshold Bit Score: 358.644
Threshold Setting Gi: 20516321
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51856639  20 LVALARAGDKEARDRLVEGNLRLVRSLVSRFSASGADPEDLFQIGCIGLLKAIDRFDLNYDVRFSTYAVPLIMGEIRRHL 99
gi 15025312  20 LIKSVHEGNKEALNKIIENNLPLVSAISRKFLNRGYEYDDIFQIGCMGLVKAVNNFNSDYKVKFSTYAVPMIMGEIKRFL 99
gi 18145712  19 LIVMAKEGNKEAMNKLIEVNTPLVSSICKRFTNRGYDYEDIFQIGSMGLVKAINNFNDSFNVKFSTYAVPMIIGEIKRFL 98
gi 28204289  22 LLEKAKNGDKKATDKLVELNLPLVSAISKKFLNRGYDYEDIYQIGCMGLVKAINNFDSSYNVKFSTYAVPMIMGEIKRFI 101
gi 20516321   9 LIKLAKNNDKASLEKLILENSGLIWSIVKKFANRGYELEDLYQIGCIGFVKAVQKFDESYNVKFSTYAVPIIMGEIKRFL 88
gi 77995918  24 LIEKAQKGDVAAREKLINCNLKLVFKVVERFLHRGYEVEDLFQIGTIGLIKAIDKFDLKQQVKFSTYAVPMIVGEIRRFL 103
gi 51974889  22 LIQKSQDGDQQARDTIVQSNMRLVWSVVQRFLNRGYEPDDLFQIGCIGLLKSVDKFDLSFDVKFSTYAVPMIIGEIQRFL 101
gi 22777523  20 LIRLSQQGDQSARDRLVEKNIRLVWSVVQRFINRGYDPDDLFQIGSIGLIKSIDKFDLSYDVKFSTYAVPMIIGEIQRFI 99
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 51856639 100 RDDGPMRVSRSLKQLAQQARRVRERLAAQMERDPTVAEVAAELGVSPEEVVAALDGVRPPTSIHQTVHEGDGDPIYLLDQ 179
gi 15025312 100 RDDGIIKVSRSVKSTARQLHYDREKLVKELNREPTIDELSKFSGIDKEEIIMATESTTSMQYLYDVVHQDDGSPVLLIDK 179
gi 18145712  99 RDDGIIKVSRSTKTLAKKLHYNKEELIKKLNRDPTVDELAEYSGVDKEEVIVALESASSMQYLYDTIHHDEGTPVLLIDK 178
gi 28204289 102 RDDGIIKVSRSLKIMARKLYYHRETLCKKLGREPSIEELSEYTGLEIEEIVYAMESSSNLQYLHDVIHQDDGAPIMLIDK 181
gi 20516321  89 RDDGLIKVSRSLKELSSKAFYMKEVLSNELNREPTINEIAERLNVTPEEIAMAFESAATAESLYDSISHEEEDR-QLIEM 167
gi 77995918 104 RDDQAIRISRSTKELGVKILKEKEALTVKLGREPTIAELEETLGYSREAIVEALEAGQSLASLFETVHQDDGDPIYLLDQ 183
gi 51974889 102 RDDGSVKVSRSLKETGNKIRKMRDELSKEFGRAPTINEVAEALELTPEEVVLAQEASRAPSSIHETVYENDGDPITILDQ 181
gi 22777523 100 RDDGSIKVSRSLKEIGNKIRRKKDEMTKQYGRSPTVNELAEALELQPEEVVHAQEAAKSPQSIYETVFENDGDPITLLDQ 179
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 51856639 180 LaADDGQREGVWLDRVALREGLNQLDERERTVILLRFFRDKTQTEVASILGCSQVQVSRLERRALERIRNYV 251
gi 15025312 180 L-SDPYSEDSDVIDKIVLKQIIKSLDNKSKQIIMLRYFKDKTQTQVANMLGISQVQVSRIEKRILKAIREKL 250
gi 18145712 179 L-SEK-GEDDDMVNKIALREAISSLDSKGKQIIMLRYFKDKTQIQVAKMLGISQVQVSRIEKKVLKIMKEKL 248
gi 28204289 182 I-SENYSEDSDIINKLALKEALGKLDAKSRQIIMLRYFKDKTQIEVAKMLGISQVQVSRIEKRVLKTMKEKL 252
gi 20516321 168 V-GDK-EDSVDLEEKLTLHMIIDKLKPREKQVIFLRYFKDMTQTEVANILGISQVQVSRIEKKVLEKIRKEL 237
gi 77995918 184 I-KQEGDEEQTLLENISIKEVLSKLEPRERYILINRFFKEKTQMEIARTLGISQVQVSRLERQALLKLKRYL 254
gi 51974889 182 I-ADQ--SETKWFDKIALKEAIRELDERERLIVYLRYYKDQTQSEVAERIGISQVQVSRLEKKILKQMKDRI 250
gi 22777523 180 I-ADQ---DSKWFEKLSLQEAIRSLTERERLIIYLRYYKDKTQTEVAERLGISQVQVSRLEKKILEDMKKNM 247
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap