Conserved Protein Domain Family
spore_yabQ

?
TIGR02893: spore_yabQ 
spore cortex biosynthesis protein YabQ
YabQ, a protein predicted to span the membrane several times, is found in exactly those genomes whose species perform sporulation in the style of Bacillus subtilis, Clostridium tetani, and others of the Firmicutes. Mutation of this sigma(E)-dependent gene blocks development of the spore cortex. The length of the C-terminal region, including some hydrophobic regions, is rather variable between members. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131939
View PSSM: TIGR02893
Aligned: 11 rows
Threshold Bit Score: 86.949
Threshold Setting Gi: 15026279
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10172687    2 SLTIQFYTMLSMAAMGVWLGAAIDTYHRFSKRRRmLFHWLEFINDVLFWLIQGLILFYVLLQVNQGEIRFYIFLAILCGY 81
gi 49332437    2 SLTIQLYTMLSMIGMGAWIGASLDTYQRFLKRQE-RKRWLVFIHDILFWIVQALFVFYVLLLVNEAELRIYVFLALLCGF 80
gi 56378431    2 NVSIQLYTMLAMIGMGGWLGLAWDTYSRMLKRHE-RAHWLVFVNDVLFWAVQALIVFYVLLFVNEGELRFYLFLALLCGY 80
gi 586888      2 TLTTQFYTMLAMSGMGLWLGASLDTYRLFVIRAK-TARWLLFIHDILFWIMQGLLFFYVLLHVNEGEFRIYIFLAVLLGV 80
gi 56908113    2 ALTVQFYTMVAMAAMGICLGAAVDTYGRFLPRQR-TFRIHIALLDIAFWIVQALLVFYILFKTNQGDIRIYVFLALLCGY 80
gi 22775747    2 TLSVQFITMISMVLSGFYLGIIQQTFRRLTTYWR-DNAFLTYFLEIGFWLTQAGVIFYVLYHVNAGEVRLYVLLACLLGF 80
gi 18146142    4 DINIQFKIVIFAILSGIIIGFLFDIYREFRGVCK--NKILITIEDILFWIWCSLIVFVFLLKYNYALIGVYVYVFMGITL 81
gi 20517452    4 TIQSQIYSFLVTVYGGFILGALYDIFKVMRKVFH-LKKAFVPAADIIFWLISTVIMLYFLYMSNYIELRFYNFLGFLFGV 82
gi 15026279    4 SIYEQLIFFISNFVAGVIAALLFDVYRVLLVCEH-PNKIVTFLEDILFLVLDAIVVFVFLLYTNEAYINAYVYVFIILGL 82
gi 51858051    3 RMELQFYALFMTVLSGIGVGLLFDLLRAVRRFLR-PGPLLAALGDLLFWGAATAMVGTGLFLGNWGEYRFYVLVGLLTGL 81
gi 489454143   4 SISKQLGLLIFSFLSGLITGVFFDIYRSIRMDKN-LSPIIKIIEDILFWCLAAIVIFIFLLYNDCAFIGVYVYLWIAIGL 82
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 10172687   82 AAYQALFRQVYQKLLERGIQFVLALYRFGRKMIHIFFVSPIKWLLNLLYRL 132
gi 49332437   81 AAYQSLLKAIYMRLLNFLIYIFVQTTHFFVQIIKLLMIKPVIIIAQLFIAF 131
gi 56378431   81 AAYQSLLRSFYVRVLEWFIGLAVRLGQTLVQLFRLMVMRPLILLGQMALAL 131
gi 586888     81 ATYQSLCKRIYIKILKFVIYLVVSVYQFFKKLIQHVLFRPIVWTCGAIIWL 131
gi 56908113   81 AAYQALFKGVYNWFVNLVITIVQAVLRFVWGLLKALIVMPIKWLLMSVRRL 131
gi 22775747   81 SIYQVFAKKPYIRMLEVIIRIVSSIYHFIRRLFDKLLLSPLKWIITLIYRM 131
gi 18146142   82 VIYLKTLSKYFRRIQHKILAILLKNLRIIFKN--------IRYAFKNTFTN 124
gi 20517452   83 LLYYFLLSEFVTEILIIVTTGIVNFFKFVAGILLKPFGTAIRFFKKPWDFA 133
gi 15026279   83 CFYIKFISPLFVSVIRKFLNQFLKCVRILFKF--------IIYILECLFLS 125
gi 51858051   82 VLHFALASPAVLWLADRLLHAVAWVLKVLWELAMRLVWFPLQAVAAVLWRL 132
gi 489454143  83 YIYIFFISKYLNPIFIYVVQNINKFFRISINI--------IVYPFKILIYK 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap