Conserved Protein Domain Family
spore_III_AF

?
TIGR02896: spore_III_AF 
stage III sporulation protein AF
This family represents the stage III sporulation protein AF of the bacterial endospore formation program, which exists in some but not all members of the Firmicutes (formerly called low-GC Gram-positives). The C-terminal region of this protein is poorly conserved, so only the N-terminal region, which includes two predicted transmembrane domains, is included in the seed alignment. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131942
View PSSM: TIGR02896
Aligned: 12 rows
Threshold Bit Score: 56.1396
Threshold Setting Gi: 10175413
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 56380780    2 QLVIEWVTNIILFLLFAVIIDFLLPSGTMQKYVKMAVGLMLVLVMLAPVLRLASVDPEQLIASALvhfsngrAGEEAIKN 81
gi 1710825     2 SFLTEWLTTIVLFILFAIVIDMLLPSSSMQKYAKMVVSLLLIVVMLTPIFKLFKTDPEVIFEYLTkn---gqSESADIKN 78
gi 22777573    2 NILIDWVTQIIIFIIIASIIDLLIPANDLKKYVRLVTGLVLILIILQPVFHLFDTDIDTVISSSMneieqqyNSTDSLEN 81
gi 49332178    2 QFVTEWIRNIIVFLLLATMLHLILPNSNLQKYVKFVVSLLLVVLILTPLFKLLQTDVNEVIANFNee---kyVAEGSVKN 78
gi 10175413    2 GFLTDWLTNLILLILLATILELLLPNSMFQRYVRMVVGLLLLVVMLQPVLAIVTEDLDTWFAELSla---tsTSELSVES 78
gi 15025077    3 EWLKQWVITICTAALFITVIEIILPDNKLKKYSKFVLGLILMTVIVQPVIKVFNNADNINKYIVN-------AQNVFEKN 75
gi 51856684    2 AALTEWVRGLVVLVVLASLLEMLLPMGGMKRFVRLAMGLVIMLGIVRPILGLLGGQVAVDPEPWLe-----pTTSLPSVS 76
gi 20516290    2 EFFKNWVVQVVNIAILAVILEMLIPSSSLKKYAKVAIGLVIMAVILNPILGFLKTAPSIEAQVFK-------SDYLLKNS 74
gi 77996672    2 ESLIKLAREIIFLLLLFTFLELLLPLGQIRNFTRAMIGLLLIMAMLTSLMELLHANWNLAVF------------------ 63
gi 28203690    4 KFLRSWIVNIATVVLFITAVEMLLPNNNLKKYSKFVMGLILMVTLINPLIKLIDKDFNINKYSYE-------FSKGIDHE 76
gi 647365622   3 QWLKEWITNIAVAVFFITAIEMLLPKNNIKKYGKFVLGLILITVILNPIIKIFNKDYNISQYVEK-------ATASFNNV 75
gi 499911960   2 ELLKNWISTLCVVIVIISIAHIILPNSSIKKHVKFAFSLIILSVMLSPIIGLLTMNKDIDETVFQ--------------E 67
                         90       100       110
                 ....*....|....*....|....*....|...
gi 56380780   82 QIEQQKKEIQASQRAYILKQMAVQLENDVNEEL 114
gi 1710825    79 QINSKKIEIQASQRAYILEEMAVQLKKKAEERF 111
gi 22777573   82 QIEFQKNEIQASQDAYILEQMAVQLENVAEDPL 114
gi 49332178   79 SIDSKKKEIQALTRAYSLEEMATKMKKEVGKEF 111
gi 10175413   79 DWNSKKDDIESDMRAYISEQMAVQLKRQVEEEF 111
gi 15025077   76 TYDQELKGSDGEEINSIVDEFKKNLEDKCSKML 108
gi 51856684   77 EIARQAERFQARTQALLLEELQDRIRRAAEEAA 109
gi 20516290   75 AFEGFSEKAKEQTKILIAKEYKNRLSQQIREKL 107
gi 77996672   64 -LPESQSKTVAVSQGSLLENARSEAEKTLEAQV 95
gi 28203690   77 ESKESFFQYKEKNIERTKENFNKNLQEVVDKKL 109
gi 647365622  76 DYKNDFDKYKKKNREETLNNFKANLQNQTKKRL 108
gi 499911960  68 KISDVTKSNEEKKSLYDEEAILKSVEKNLEKSL 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap