Conserved Protein Domain Family
spore_yutH

?
TIGR02905: spore_yutH 
spore coat protein YutH
Members of this family are homologs of the Bacillus subtilis spore coat protein CotS. Members of this family, designated YutH, are found only in the family Bacillaceae from among the endospore-forming members of the Firmicutes branch of the Bacteria. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131951
View PSSM: TIGR02905
Aligned: 5 rows
Threshold Bit Score: 481.183
Threshold Setting Gi: 145903143
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10176046    3 ERNVYDSFQLYCDSRFRTGRFQGFYAQGQPYLLVPREQIEPDEEAAILEMGEYLQRAGDGTVLKLIKAKTGPLHAKIDGQ 82
gi 145903143   4 KELIKEKFGIYIRDLTSYLSYQAFHTPNSMFLIVPVSHLSQDELAELFSMSQYLQEQRDPYVSSFILTKDGEMTFEENGV 83
gi 89100553    3 RQMLKQHFGIQAEEELRIGLHEAFKKDNQLYIPMEV-GLEEEDLAELSLIASHLQQTGDKTVSTFLQTTEGKHSSVWEQK 81
gi 56381343    2 EEWVREQYGMRVERLERSGRHAAFWHRQERFLLVPADGQSEAEMEERQRMSRYLRAKGVDGVGELVKTTSGTYIASYNGQ 81
gi 56910950    3 ERNLYDQYKLYCDERFTVGPYEGFRANNQAYIILPKDECMAEEV-EMMAFCDFMRQAGDESVLELVPNRFNQSSALIDGV 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10176046   83 DVYLFQIPYEYERFGMlqt-deDIGRHLATFHQAGAQYVGTAYQKGAYGKWPRLWEKRLEQLEEWHQRLLAQGPRTLVDE 161
gi 145903143  84 SYVLLQAAPRMTNRSV------SFGAELAEFHHKGRGYPYEVKETSRIGQWKELWGKRLDQLEQFWIQKTQARQLQPFEK 157
gi 89100553   82 SYCVLKCPNAQPRKGY------QSGRKLAKFHYRGRLISSPITRTSRIGQWKQLWEKRLDQMEKVWNSMLFQQPEHELDR 155
gi 56381343   82 PLALVRAPLPAARFR-------SLGRELAVMHECGRTCPWPIVACRRIGQWRELWAKRIDQMEAFWSSKLASGPSSLFDR 154
gi 56910950   82 EAYVFKVPEFNEFRGVriqsewDLGEQLFTWHKRGQQ-GRQHWKKASFPPWQELWATRLEQLEDWYQALVNQGPQTTTDE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10176046  162 QFLFTFPYYLGMTENAIQFAVDAHYDEGGIERERGTICHKRFHNDTWi--rLENGRLKVPTEFVYDHPSRDLAEWLRS-K 238
gi 145903143 158 QFIESFPYYLGLTENAIQYLADTELDDQPQAADSGTICQQRLTCEAL----RREPLIKIPMEWVFDHAARDLAEYARS-L 232
gi 89100553  156 MFLETFPYYMGLAENSIQYLADAELDDEPGPADSGTVCHERFVSSTWg---SDDYLIKSPFDWVFDHASRDLAEWSRE-R 231
gi 56381343  155 LFIESFPYYLGLAENAVQYVADTEIDEEPGRIDYAAFCHERLPEAKW----VGGGEAKLPTDWVYDHCARDLAEWVRH-L 229
gi 56910950  161 AFLCTYPYFMGMTENAIQFAVDTQLDVKKELHDEPTICHRRFGETSWlymsERGHIVKPPTAFLYDHPARDLAEWIREnR 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10176046  239 EleIARPEDRalAIQSFLHAYGQHAPLTRLCRRFIFARLLFPVHYFQTIEDYYSCQiEEKRRTLEKEVLHLFEKETTHEQ 318
gi 145903143 233 F--HERKNFN--EIMLFLQQYEQAAPLSSFSKRLMYSRLLFPLHYFETLEGYYISP-ESEHHYFESRLDYLLSQAPAYEQ 307
gi 89100553  232 YfrNIKTYQP--GLSQYLKEYQTVEPLTSFSWRLLYARLLFPLHYFECIENYYGNPtEHQRHLSEEQLGRFLQHTGDHEE 309
gi 56381343  230 YekSGLGCQR--AVRQFFQEYEHAAPLSPFAWRLVYARLLFPLSYFECVEAYYIAVdESERTRREGELRRLLDRSHEYER 307
gi 56910950  241 PmgEIRQNWE--RIASFFGGYEEWQVLTPYTWQMMYARLIFPLHYFEVIENYYQAQlPHEQREYGKQFQQLLDRETSNAD 318

                 ....*
gi 10176046  319 FLRMV 323
gi 145903143 308 FLNGF 312
gi 89100553  310 FLGKF 314
gi 56381343  308 FLAAF 312
gi 56910950  319 FLGEL 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap