2Q83


Conserved Protein Domain Family
spore_CotS

?
TIGR02906: spore_CotS 
Click on image for an interactive view with Cn3D
spore coat protein, CotS family
Members of this family include the spore coat proteins CotS and YtaA from Bacillus subtilis and, from other endospore-forming bacteria, homologs that are more closely related to these two than to the spore coat proteins YutH and YsxE. The CotS family is more broadly distributed than YutH or YsxE, but still is not universal among spore-formers. [Cellular processes, Sporulation and germination]
Statistics
?
PSSM-Id: 131952
View PSSM: TIGR02906
Aligned: 16 rows
Threshold Bit Score: 318.071
Threshold Setting Gi: 28203434
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2Q83_A       37 IDVIQGNQXAL--VWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGx-NVPGILPNKKGSLYSKHGSFLFVVYDWI 113
gi 2635576   48 IDVIQGNQMAL--VWKVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGm-NVPGILPNKKGSLYSKHGSFLFVVYDWI 124
gi 67874375  30 ISVVQSANIKT--VWRIKTKDRELCLKRLKHPLDKALFSVNAQDFIYNHGg-NVAGIIRDKEGNLIHSFNDQLFVVYEWL 106
gi 56379214  42 MQIVTTKPDKGgaIWKLETKSGPKSLKLLHRRPTRSLFSLGAQEYLVEVRkaRVPPIVKTKDEKSYVEAGGKLWFVAEWI 121
gi 28204078  36 IKFKNTDKQRA--VYKVSHGSKNYCLKKVYFPEEELLFVYSAIEWMHRYNi-KVPRILPTLESNRFVNYENMLFILTPWI 112
gi 15025959  16 INAEASQKIKN--VYRVNSSSKNYCLKCIHYDYGHVLFIVKAMEHLKENGfdKIPEIIPTSSGEKFIKFRSCYVYLTEWL 93
gi 18145887  16 IEVKEVIKVKN--TYKIITSDEEYCLKVIKYQYPHFYFIVSAQKHLMKNGfnSIPKILDTIDGKDYVRLDDKLAYLTPWV 93
gi 18145885  27 LDIFDLRPNRN--VFLLDTKQGKKILKMINYDDDRLNFIIHSTEYLRERYd-GILKINKLPNGEWRFKWKGNYYILLDYF 103
gi 82748904  27 IKVNDIVPLRK--VFLVYTDEGNKILKRVNYDVDRVNLISDSLDYVKKSYe-HVITYKRFKDDLCYKEWNGQIYIVMDIL 103
gi 28203434  37 LQVLSIERVRS--VYKVETNCGNICLKEIAKNKRKPVNGSILVEELDKHGfpYIAKYFKTTDDHLFVKYNKSYYYVTEWI 114
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2Q83_A      114 EGRPFE--LTVKQDLEFIXKGLADFHTASVGY-QPPNGVPIFTK--LGRWPNHYTKRCKQXETWKLXA-EAEKEDPFSQL 187
gi 2635576  125 EGRPFE--LTVKQDLEFIMKGLADFHTASVGY-QPPNGVPIFTK--LGRWPNHYTKRCKQMETWKLMA-EAEKEDPFSQL 198
gi 67874375 107 YGRDLS--FVNADDLKSALHGLAKFHIASKGY-VAPEGAKVSSK--LGRWPEQYKSMADKLSSWKEAS-LGKPASASVNA 180
gi 56379214 122 EP--LTpvTKDLEGARKLCYALGEFHRLSKGY-VPPKQAEMASR--LHKWPKNYEKMITKMSWFRNIA-KYYPEMPASPP 195
gi 28204078 113 EGCKCD--YDNPIHVTRSTENLSLMHHHSSKF-FPILGSDNREK--FDNVYDTTEKRFNQLLECSNLA--FKYKDKFSKY 185
gi 15025959  94 DARVCN--FDNPIDLYTAVKALSSLHLKSRSF-EVTDNMNPRVG--WFNWRENFKRRKDEILKFKKIIcDKEKKTEFDNL 168
gi 18145887  94 KCRECD--YKNKWDLSLAAKKLSELHNSSEGF-VINRDLKPRIA--WGKWYKIFETRGEEILDFKKRIyQKAYMSDFDKL 168
gi 18145885 104 EGTEFN--IANPIELEIITDAVAKLHNAGMGIqEATSKEMNEKNseLFKLKDYFKNSKKDLEKLKEIVgSYKYKNEFDEI 181
gi 82748904 104 NGREAS--FSNPVEIDLCAENIALMHKASKGLrEYLKDKYKKDFldIS-LKDKIKEAYDDLIWMKSLVdTYKYKNEFDKL 180
gi 28203434 115 NGHECN--LNDINEARKCMKLMANFHITTFKI----DGSKLKLRnnLKNWPKIFFSKLKDIQYFKHIIkNKRVVTEFDNL 188
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2Q83_A      188 YLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGE-NEqIWVIDLDTVSFDLPIRDLRKXIIPL 266
gi 2635576  199 YLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDYGTGNTLLGEnEQ-IWVIDLDTVSFDLPIRDLRKMIIPL 277
gi 67874375 181 YLKNVDEMLDICHRAMELLNASKYAELAGENSKSAVLCHQDYGKGNALFTD-NG-VYVIDLDGVTWDHPGRDLRKIIGKL 258
gi 56379214 196 LLEVVDRFEEQARKGMERFLQSSYVEFVKQGTAHWGLVHQDYGWSNGQMGA-DG-MWIIDLDGVAFDLPIRDLRKLISGT 273
gi 28204078 186 FLSHFDANLNTAKNILALSCTINHNNLQKNL------CHLDYVNKNIILDNnNN-VWVIDFDKCRIDYRVHDIGYFMRRY 258
gi 15025959 169 YMKLMEEELSKADKSIQDIENSEYVNKMNEEFRLKGFCHHDYAHHNILIDKeGK-AHIIDFDYCMLDTHLHDLSSILIRK 247
gi 18145887 169 YLSIMDEELKRVERTLSHIKTSGYFDYMKKEVKKLGFCHHDYANHNVLLLEnNE-INIIDFDYCILDSHLHDLSSLCIRT 247
gi 18145885 182 FIKEVDYHLSDVEKCIDLLEKSKYDDLCRDKEKITL-CHNDLAYHNILFNQ-NK-VSFIDFDYCNINLRVIDLCNFIIKS 258
gi 82748904 181 FVNNVDKYLNEIKEVQNDLEKSSYDNLRQDGDTIRL-CHNDLAYHNFLTKN-NE-INIIDFDFMTIDLRVMDIWNFILKC 257
gi 28203434 189 YNSVIDDFYNMGITALHLLNSSDYYSLSRKANSKRSICHDSIYYQNIIKKD-DD-YYLIDLDSIKIDIHINDLGKVIRRL 266
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2Q83_A      267 L-DTTGVWDDETFNVXLNAYESRAPLTEEQKQVXFIDXLFPYELYDVIREKYVRKSALPKE----ELESAFEYERIKANA 341
gi 2635576  278 L-DTTGVWDDETFNVMLNAYESRAPLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKE----ELESAFEYERIKANA 352
gi 67874375 259 S-ENRGAWSLDQIEKILDWYSEINPLSTADRELIYIDLMYPHWFFGLVKNIFKNNKSESPS----KIEKTARLETSKVPL 333
gi 56379214 274 M-ADLYKWDATWVREMILAYHEANPITPELYELLMIDLAMPNEFYKNMKEVVYEPEIFLNEqtaqLIQTIVETDQSKWPV 352
gi 28204078 259 LrRDNTSWDVKKAIECIEIYEGINPLNLDEHKYILCYIGFPQKFWKISRDYYRNIKRCNKNsffkVLTSSIEKEKEQDDF 338
gi 15025959 248 M--KNGLWDMKCCLFILNTYNEDYKIENNDIPIMASFMEFPQGYWQVGLQYYVEKQPWTEEffmsRLNKIYKDKDERQEF 325
gi 18145887 248 M--KEGRWDLNLFKYIIESYSKNKEVRNEEFPIIASFIEFPQAYWQLGLQYYWEQQPWEEEhflkKLGKYEKDREFRQNF 325
gi 18145885 259 I--KRFGFSLEMYDSIIEKYDKLNNLSKEEKELMYIYLRFPHDFYTVSMQYYYKLKDWKYEsflnKLERKLEYTKEKEIL 336
gi 82748904 258 I--KNAAFDVDKMSTCINGYENVSILKKEEKELLYILIKFPKDFYTISRDYYHKRKNWEYEvylsRFEGKLSNEDFRYEF 335
gi 28203434 267 MfKKEYQWDFNKAKELIEAYSSANPLDKADLGAMLSIIVFPHKFWKLGKNRYVKEKHWSEEkyikKLNKLIDFDVLQQKF 346

                ....
2Q83_A      342 LRQL 345
gi 2635576  353 LRQL 356
gi 67874375 334 LAEK 337
gi 56379214 353 LAEI 356
gi 28204078 339 VIDF 342
gi 15025959 326 LEDF 329
gi 18145887 326 VDEL 329
gi 18145885 337 LNHI 340
gi 82748904 336 LKVL 339
gi 28203434 347 IKDY 350
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap