Conserved Protein Domain Family
spore_YkwD

?
TIGR02909: spore_YkwD 
uncharacterized protein, YkwD family
Members of this protein family represent a subset of those belonging to pfam00188 (SCP-like extracellular protein). Based on currently cuttoffs for this model, all member proteins are found in Bacteria capable of endospore formation. Members include a named but uncharacterized protein, YkwD of Bacillus subtilis. Only the C-terminal region is well-conserved and is included in the seed alignment for this model. Three members of this family have an N-terminal domain homologous to the spore coat assembly protein SafA.
Statistics
?
PSSM-Id: 131955
View PSSM: TIGR02909
Aligned: 8 rows
Threshold Bit Score: 224.235
Threshold Setting Gi: 20516690
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 10174421   80 HLNFEEEVVRLVNQERAKHGLNPLKSNWELARVARIKSEDMRDRNYFSHTSPTYGSPHQMIRNFGI-SYR-SSGENIAaG 157
gi 77995871   56 LTADEKRFLELTNQARIKNGLKPLAVDPRLVQTARLKAEDMAKLGYFGHISPTYGKPSTMMIAYGIkDYRwIGGENLA-Q 134
gi 10175499  132 LTQDEQRMIDLVNEERQKNGLQPLKANLEITKVARVKAQDMIDNNYFDHNSPTYGSPFDMMRQFGI-EFR-TAGENLA-G 208
gi 20516690   86 LSQEEKTLVELVNKERKKNNLLPLQVDENLCKVARLKAEDMRDNDYFSHISPNYGSPFDMLKKFGI-NYY-MAGENIA-V 162
gi 225184951 133 VSAYEKKVVELTNAERQKQGLKPLQIDETLSKSARAKSQDMKDKNYFDHQSPTYGSPFDMMKSFGI-SYK-TAGENIAkG 210
gi 51857319  287 IHEFERRVAELVNAERLAAGLQPLRLDPGLSRVARLKSRDFVTGGYFGHESPTYGSPFEMMKQFGF-TYR-MAGENIAlG 364
gi 15025229   48 LAAEESQVIKLVNSQRAKYGLAPLKANTQLINIARVKSRDMMMKNYFSHTSPTFGSTFSLLTRYGL-SYA-AAGENIAyG 125
gi 544702895 127 VAALENEVVTLVNAERAKAGLPALKANAELSNVARLKSQDMIDKKYFSHTSPTYGSPFDMMKKFGV-KYS-AAGENIAsG 204
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 10174421  158 QSTPQAVFQAWMNSSGHRQNILSSNYTEIGVGYARGGSY-GHYWTQMFIG 206
gi 77995871  135 NSTVDRAFNALMNSPTHRANILDPRYTHIGVASVPGGRY-GKLWVQHFCG 183
gi 10175499  209 NQTVEAAHQALMNSQGHRANILSPNYTEIGVGVVEGGPY-GKMFVQMFKG 257
gi 20516690  163 NSNVIKAHYSLMNSEGHRANILNPYYNKIGVGIVKNKQGnGIIVVELFIK 212
gi 225184951 211 QKTPEEVVKAWMNSEGHRKNILNPNFTHIGVGYVESGSI----WTQQFIG 256
gi 51857319  365 HRTPEQVHEAWMNSPGHRSNILNPDFDTIGVGYYEYG------WTQMFIQ 408
gi 15025229  126 YNNAASVMNGWMNSPGHRANILGRQYREIGVGAARSRSG-KIYWTQVFIK 174
gi 544702895 205 YPTAKAVVDGWMNSPGHKANILSKSFTEIGVGLAKSSDG-TYYWTQMFIN 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap