Conserved Protein Domain Family
sulfite_red_B

?
TIGR02911: sulfite_red_B 
sulfite reductase, subunit B
Members of this protein family include the B subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131957
View PSSM: TIGR02911
Aligned: 4 rows
Threshold Bit Score: 487.377
Threshold Setting Gi: 15024461
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15024461    4 NEYVPFLSEIKEVIKHTNIEYTFRMSYDGVVKPGQFFEVSIPKYGEAPISVSGVGENTVDLTIRRVGKVTNEVFERYVGD 83
gi 28204510   13 NIYLPFKSTILEIIPHTDIDYTFRMEYKGDVKPGQFFEVSIPKYGEAPISVCGIGENYIDLTIRKVGKVTDVVHTFFPGG 92
gi 20141220   12 HSLLPAAYRILSITRHTPLEWNFRVAVDFPAHWGQFVEVSLPRVGEAPISVSDYGDGWIDLLIRNVGKVTSALFTLKEGD 91
gi 500499046   5 NVYMPFKSEILDIKKHTDIEYTFRMSYEGEVKPGQFFEVSLPKYGESPISVCEIGEGYVDLTIRRVGVVTDEIYNYNIGQ 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15024461   84 KLFLRGPYGNGFDVENYKDKEIVIVAGGTGVSPVRGVVEYFAKNSKEAKSVTLIAGFKTPKDILFSEDFKEWKNNINIIL 163
gi 28204510   93 HFFMRGPYGNGFDVDLYKGKELIIAAGGTGLAPVKGVIEHFTKNINNVKSLNVLCGFKSPEDILFKKDIAEWEKTIGFTL 172
gi 20141220   92 NVWLRGCYGNGYPVDTLRHKPLLVVAGGTGVAPVKGLMRYFVENPQEIGQLDMILGYKNRDCVLYKEEMATWRGKHNLVL 171
gi 500499046  85 SLFLRGPYGNGFNLDNYKNKEIVVVAGGTGVAPVKGIVDYFSKNPKECKEFNLIVGFKTINNILFKEDIEKWKENINVTV 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15024461  164 TVDSAEGDSNFKEGLVTKYIPELKLQNVKEASAIVVGPPAMMRFSTQGLLDVGFKEENMWISQERKMCCGIGKCGHCKID 243
gi 28204510  173 TVDNADEDYKGNVGLITKYVDKIDIKNIEEVNVIIVGPPIMMKFTVQEFLKRGIKQENIWVSYERKMCCGVGKCGHCKID 252
gi 20141220  172 TLDEGEADDRYQIGRVTDRLADMTLSDIDTMQAIVVGPPIMITFTVKMLLQKGLKPEQIWVDYERRMACSVGKCGHCRMG 251
gi 500499046 165 TLDVAEEGYKGNTGLVTKYIPELNIKDKENVQVVVVGPPIMMKFAVAEFLKLGIKEENIWISQERKMCCGLGKCGHCKID 244
                        250       260
                 ....*....|....*....|.
gi 15024461  244 DVYVCLDGPVFNFTKGKNLID 264
gi 28204510  253 DTYICLDGPVFNYTKAKQLVD 273
gi 20141220  252 EVYVCTDGPIFNYAVAQRFAD 272
gi 500499046 245 DTYICLEGPVFNYVKGKTLID 265
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap