Conserved Protein Domain Family
sulfite_red_C

?
TIGR02912: sulfite_red_C 
sulfite reductase, subunit C
Members of this protein family include the C subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum. Note that any one of these enzymes may have secondary substates such as NH2OH, SeO3(2-), and SO3(2-). Heterologous expression of the anaerobic sulfite reductase of Salmonella confers on Escherichia coli the ability to produce hydrogen sulfide gas from sulfite. [Central intermediary metabolism, Sulfur metabolism]
Statistics
?
PSSM-Id: 131958
View PSSM: TIGR02912
Aligned: 4 rows
Threshold Bit Score: 546.771
Threshold Setting Gi: 60391778
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15024462    2 DINTKNLK-KNAFRVTKRRGITASRIRVPGGHLEAKFLSMIQNIAENYGDGSVHITSRQGFEIPGIKFEDMPKVNELLQP 80
gi 60391778    4 DIDIIKARaKNEYRLSKVRGEAMISVRIPGGILPAHLLTVARDIAETWGNGQIHLTTRQKLAMPGIRYEDIDNVNAALEP 83
gi 28204509    2 DINTKALK-KNAFRVTKERGKTAARVRVPGGYLDAKYLSLLQNIAETYGNGKLHITIRQGFEIPGIPMKYIPEVNKALQP 80
gi 500499047   2 DINTKAIK-KNAFRVTKHRGKTALRVRVPGGNLPVKYFAILAKIAEEYGNGKVHVTTRQGFEIPDLDFNKMDEINKLIQP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15024462   81 IIEGLNINQETALQ-----GYSASGTRNITACVGNRVCPYGCYDTTSFAQRIEKAVFPHDLHFKIALTGCPNDCAKVRMH 155
gi 60391778   84 FLREIEIELCDVQVedtkaGYLAIGGRNIVACQGNRICQKANTDTTGLSRRLEKLVYPSPYHLKTVIVGCPNDCAKASMA 163
gi 28204509   81 IIEGLEINQENPNK-----GYSASGTRNVSACIGNNVCPFANYNTAKFAKKIEKAIFPNDYHVKIALTGCPNDCIKARMQ 155
gi 500499047  81 VIEGLNISQDEVGK-----GYSAAGTRNVTSCIGNEVCPFANYNTTKFAKRIEKAIFPNDYHVKVALTGCPNDCIKARMH 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15024462  156 DFGIMGMTEPHYESDTCVSCGACVKVCKKKSVGALSAVNYKVVRRGEKCIGCGECVLKCPTGAWTRSEKTYYRLTLLGRT 235
gi 60391778  164 DLGIIGVAKMRFTADRCIGCGACVKACSHHAVGCLALKNGKAVKEESACIGCGECVLACPTLAWQRKPDQLWQVRLGGRT 243
gi 28204509  156 DFGIIGMTEPQYDAYRCIGCQACVNVCKKKSTGALSFENYKVVRDHSKCIGCGECINKCPTSAWSRSEEKYFKLVIMGRT 235
gi 500499047 156 DFGILGMTEPQYDKYRCVGCQACVNNCKKRATGALRFENFKVIRDHEKCIGCGECIGKCPTGAWTRSKEKYYKLAIMGRT 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15024462  236 GKKNPRLGEDFIKWVDEDSIIKIILNTYDYvtkyiDPNAPGGKE---HIGYIVDRTGFEEFKKWALKDVKLPSIAEVYTP 312
gi 60391778  244 SKKTPRVGKLFLNWVTEDVIKQVIVNLYEF-----EKEMLGGKPiylHMGHLIDKGGYLRFKERVLRGVQLNPEAMVAER 318
gi 28204509  236 GKKNPRIARDFITWIDEDSIVKIILNTYDYideyiDRNAPGGKE---HIGYIVDRTGYQEFKKWALKDIELSPKAKVEHN 312
gi 500499047 236 GKKNPRLAEDFIKWVDEDSIVKIIINTYDYiheyiDKDAPGGKE---HIGYIVDRTGYQEFKKWALKDVNLKEKAELAEN 312

                 ...
gi 15024462  313 IYW 315
gi 60391778  319 IYW 321
gi 28204509  313 INW 315
gi 500499047 313 INW 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap