4PQG


Conserved Protein Domain Family
TIGR02918

?
TIGR02918: TIGR02918 
Click on image for an interactive view with Cn3D
accessory Sec system glycosylation protein GtfA
Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. Members are associated with glycosylation of serine-rich glycoproteins exported by the accessory Sec system. [Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 131964
View PSSM: TIGR02918
Aligned: 9 rows
Threshold Bit Score: 835.5
Threshold Setting Gi: 41582768
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4PQG_A        9 MTIYNINLGIGWASSGVEYAQAYRAGVFRKLNLSSKFIFTDMILADNIQHLTANIGFDDNQVIWLYNHFTDIKIAPTSVT 88
gi 55738373   1 MTVYNINLGIGWASSGVEYAQAYRSTIFKNTGIKAKFVFMDMFLQDNLSDLARNMGFSDEDIIWLYSYFTDLKIAPTTYT 80
gi 14973254   1 MTIYNINLGIGWASSGVEYAQAYRAGVFRKLNLSSKFIFTDMILADNIQHLTANIGFDDNQVIWLYNHFTDIKIAPTSVT 80
gi 74054334   1 MVVYNLNRGIGWASSGVEYAQAYRSEVFRKLGVEAKFIFTDMFQNENIEHLTRNIGFEDNEIIWLYTFFTDLTIAATSYS 80
gi 72493934   1 MTIYNINFGIGWASSGVEYAQRYRAQLLRKCNETIKFVFLDFIKNENIQTLTENIGFKNEEIIWLYQYFTDIKIAPTSVT 80
gi 27316710   1 MTIYNINFGIGWASSGVEYAQVYRAKLLRQLPYPTKFIFLDFIQSENIQTLTSNIGFKDDEVIWLYQYFTDVKIAPTTYT 80
gi 13702606   1 MTIYNINFGIGWASSGVEYAQAYRAKLLRRTNQDTKFVFLDFIQSENIQTLTQNIGFKDQEVIWLYQYFSDISIAPTTYT 80
gi 68445766   1 MTIYNLNFGIGWASSGVEYAQLYRRNIFKLMKENFKFIYLDFIQKENIQTLTENLGFEDDEIIWIYQYFTDIKIAPTTYT 80
gi 41582768   1 MTVYNINLGIGWASSGVEYAQKYRDQSFDKVGIERKFIFSDLILGNNIGDLTANLGFDNDNIIWLYNFFTDVKSSTSNYS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4PQG_A       89 VDDVLAYFGGEESHREK-NGKVLRVFFF-DQDKFVTCYLVDENKDLVQHAEYVFKGNLIRKDYFSYTRYCSEYFAPKDNV 166
gi 55738373  81 VKDLEKEIPYDITRREI-NGKVVKLFCT-KEDIFYAAYLRKEGEDIVHRVEKVSRGCLIRKDFYSYTKMFTEYYTPVDNK 158
gi 14973254  81 VDDVLAYFGGEESHREK-NGKVLRVFFF-DQDKFVTCYLVDENKDLVQHAEYVFKGNLIRKDYFSYTRYCSEYFAPKDNV 158
gi 74054334  81 LQQLKESFSLPIDRTEK-NGKIISFFFK-GSSIVVTVMLNDESSNIVQRVEYLMGGKLVRKDYYSYTKMFSEYYAPEDIG 158
gi 72493934  81 VDEIIKPLYSEITKVEN-QGKTRKIHFN-HNSNYLVCYLKNEDSDVVDRVEYISRGKLLRRDYYSYVRVLSEYFAPEDNS 158
gi 27316710  81 VDDLISELGNEVTRKEQ-NGKVLRLYLN-NQQTFVTCYLKNANEHYVDRAEFVVNGMLIRKDFYSYVRTFSEYYAPFNNK 158
gi 13702606  81 LDDIERELGHEISFRER-NGKIVRLYFN-GKSSFVTCYLQNEQKDVVDRAEFVINSMLVRKDFYSYTRIFSEYYAPADNK 158
gi 68445766  81 IQNIIDRLEDTNVEIERvNNKIKKIIFG-NDNNYIRCYLKNESENIVDRAEYVSKGKLIKKEFYNFTIVFTEYYAPYEKK 159
gi 41582768  81 LDTLENELNLKKLSSNV-KTVGKEVFYQlNDGLQLVARLSDAEKRTIDQVSYVKNNTLLKRDFYSYTKYACEYYLGADKD 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4PQG_A      167 AVLYQRTFYNEDGTPVYDILMNqGKEEVYHFKD-KIFYGKQAFVRAFMKSLNLNKSDLVILDRETG-----IGQVVFEEA 240
gi 55738373 159 AHLYQRRFFNEDGSIAYDEIVD-GKDSVFRFPD-KILSSKQEFIAYFMSQLGLTDQDIVILDRATG-----TGQAVFRNT 231
gi 14973254 159 AVLYQRTFYNEDGTPVYDILMNqGKEEVYHFKD-KIFYGKQAFVRAFMKSLNLNKSDLVILDRETG-----IGQVVFEEA 232
gi 74054334 159 PCLYQRTFYNEDGSVAYEENVD-GENSIFKFKE-TILYSKEELVGYMLEKLQLTNSDLILLDRSTG-----IGQAVLRNK 231
gi 72493934 159 AKLYMRSFYNEDGSIAYNEYVN-DEESMFVFED-NILYGKQALIACFLEKLHLTDKDMLIVDRSKD-----IGQTVLQNK 231
gi 27316710 159 AKIYMRQFYNENGSIAYREYID-EDEHVFVFDD-ARLYSKQALVAYFIRQLLLNSEDIIIIDRATD-----VGQAILENK 231
gi 13702606 159 AKLYMRQFYNEDGSIAYNEYID-GDSSIYVFED-AVLYNKTEFIAYFLQRLNLTRDDIVILDRASD-----IGQAVLQHK 231
gi 68445766 160 AKLYLRTYFNEDGSIAYEEHIS-GKNSIFVFPN-VILYSKLEFIAYFLRQLNLTREDILLIDRSKN-----IGQVILENK 232
gi 41582768 160 NRVTFREFYNEDGTIAYTQHLN-GDQETFEFANgEVIYSKDDLYLKMLKELNFTKKDVIILDREDEdknliNGQLVFENH 238
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4PQG_A      241 QTAHLAVVVHAEHYSENATNEDYILWNNYYDYQFTNADKVDFFIVSTDRQNEVLQEQFAKYTQHQPKIVTIPVGSIDSLT 320
gi 55738373 232 KPAKLGVVVHAEHFSENAVTDKTILWNNFYEYQFSNADKVDFFITATECQRSIMLDQFNKYTPFKPHIVTIPVGSVDKLR 311
gi 14973254 233 QTAHLAVVVHAEHYSENATNEDYILWNNYYDYQFTNADKVDFFIVSTDRQNEVLQEQFAKYTQHQPKIVTIPVGSIDSLT 312
gi 74054334 232 GNAKVAVVVHAEHYNVSATDETTILWNNYYDYQFSNADSIDAFITSTETQTKTLIDQFKKYLNIEPVVYTIPVGSLSKLQ 311
gi 72493934 232 GPARLGVVIHAEHYNESTTNDTYILWNNHYEYVFMNAHEIDFFITATDIQNQLLAQQFEKNYHRKPKIYTIPVGSLSTLV 311
gi 27316710 232 GSSKVGVVVHAEHFSEGATDGTHILWNNYYEYQFENAQHIDFFITATDLQRQTLSEQFKQYKNDCPRIRTIPVGSIESLQ 311
gi 13702606 232 GDSKVGVVIHADHYSNNMMSEQHILWNNYYEYQFSKAKYIDFFITATDIQNHMVCRQFEQYQGYRPRVYTIPVGSIDALS 311
gi 68445766 233 NQARLGVVIHAEHFNHSNTNEDYILWNNNYEYMFNHVDYIDFFITATDAQKQLIVNQFNQYKNKNPKVYTIPVGSLKELK 312
gi 41582768 239 GPAKLVVVVHADHFDKHYTTDQNILWNNFYEYQFQHAKYVDSFIVATNEQKKILKNQFKKYYNIEPRIDCIPVGSLNELE 318
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4PQG_A      321 DSS-QGRKPFSLITASRLAKEKHIDWLVKAVIEAHKELPELTFDIYGSGGEDSLLREIIANHQAEDYIQLKGHAELSQIY 399
gi 55738373 312 EPE-GERKPFSIITASRLANEKHVDWLVKAVVKAKESLPQVNFDIFGTGAEESKLKAIIEENQAQDYIHLKGHQDLIEVY 390
gi 14973254 313 DSS-QGRKPFSLITASRLAKEKHIDWLVKAVIEAHKELPELTFDIYGSGGEDSLLREIIANHQAEDYIQLKGHAELSQIY 391
gi 74054334 312 RKEwHERKAFSLLTCSRLASEKHIDWLINAVVEANKVIPELTFDIYGEGGERQKLQEIIAKNKANNYIRLMGHKNLSSVY 391
gi 72493934 312 KP--NRRKPYSIITASRLATEKHVDWLVKAVLKAKASVPEITFDIYGEGGQRQLLSKLIQENHAEDYITLKGHVNLNQVY 389
gi 27316710 312 YPE-KERKPYSIMTASRLANEKHVDWIVEAVIKAKHQLPQLSFDIYGQGEEQEKIKNIITKHRAEDYIQIKGHRNLRTIY 390
gi 13702606 312 YPK-LSRKPYAMISASRLANEKHIDWLVKAVIVAKRQVPELTFDIYGEGSEKTRLRKIIDTHRAQDYIRLLGHVKLDEIY 390
gi 68445766 313 YT--HERASNSIMTASRLAKEKHVDWLIESVVQAHKTRPSIKFDIYGEGAEKNNLQKLINEKEANEYIKLRGHKNLEEIY 390
gi 41582768 319 HPT-QGRMKHSLITASRLAKEKHIDWIVNAVVAAKNSVPDLSLDIYGTGGEAGMLTNLINQNQAQDYIHIMGQRDLTKVY 397
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4PQG_A      400 SQYEVYLTASTSEGFGLTLMEAIGSGLPLIGFDVPYGNQTFIEDGQNGYLIP-SSSDHVEDQiKQAYAAKICQLY-QENR 477
gi 55738373 391 KDYELYLSGSKSEGFGLTLLEAVGSGLGMIGFDVRYGNQTFIKDNENGYLIP-RFEKDDEPAiVAALAEKIVAFF-NRSD 468
gi 14973254 392 SQYEVYLTASTSEGFGLTLMEAIGSGLPLIGFDVPYGNQTFIEDGQNGYLIP-SSSDHVEDQiKQAYAAKICQLY-QENR 469
gi 74054334 392 KDYQVYLSGSTSEGFGLTLMEAIGSGLPIIGLDVPYGNQTFIENNLNGYLIP-RETPDNPQQiSTAFAQYIVALF-NSKD 469
gi 72493934 390 QDYELFLSGSTSEGFGLTLMEAIGSGLGMIGFDVNYGNPTFIKHQKNGYLIPiDLNEDKESEiIDHLAEGIVNYF--DND 467
gi 27316710 391 QQYELFIAASQSEGFGLTLMEAVGSGLGMIGFDVNYGSPTFIRHHQNGYLIPiDFEQASTDDiTTQIAHMIIRYF--EDG 468
gi 13702606 391 NDYELFLSASTSEGFGLTLMEAVGSGLGMIGLNVNYGNPTFIRDGENGYLVPfDTDEDSVDDvIAKLAHAIVMYF--NNG 468
gi 68445766 391 KKYQLYLSGSTSEGFGLTLMEAIGSGLGIIGFDVNYGNTTFIKDRYNGYRIPeSIKNQGTKEiATKFAEKIDEYFvSSNK 470
gi 41582768 398 RNYPAYIAASTSEGFGLSLLEAVGSGLAMIGFDVPYGNPTFIENEKNGMLLPyNEEWTDFRK-EEVLTKAIIEMF-TKSD 475
                       490       500       510
                ....*....|....*....|....*....|.
4PQG_A      478 LEAMRAYSYQIAEGFLTKEILEKWKKTVEEV 508
gi 55738373 469 LDHIHQVSYDIAKGFLTEEIEQKWLNLVREM 499
gi 14973254 470 LEAMRAYSYQIAEGFLTKEILEKWKKTVEEV 500
gi 74054334 470 ICKKHEYSYRIASRFLNDKIIENWSFFLRRL 500
gi 72493934 468 TSRFNQASYEIAENFTQPVVVQKWNNLISEV 498
gi 27316710 469 PIRAHEVSYDIAESFKTSHIVDLWRQLIEEV 499
gi 13702606 469 PQAPHDISYEVAQQFMTQDIILKWETLVQEV 499
gi 68445766 471 IDQMSHESYLIADDFLLNNCKEKWLSLVNEV 501
gi 41582768 476 VDSFNKKSYQIAEPYLTANVAKQWKKLVGGI 506
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap