Conserved Protein Domain Family
PEP_integral

?
TIGR02921: PEP_integral 
PEP-CTERM family integral membrane protein
Members of this protein family, found in eighteen genera so far, have a PEP-CTERM sequence at the carboxyl-terminus (see model TIGR02595), but are unusual among PEP-CTERM proteins in having multiple predicted transmembrane segments. The function is unknown. It is proposed that an exosortase (see TIGR02602), recognizes and cleaves PEP-CTERM proteins in a manner analogous to the cleavage of LPXTG proteins by sortase (see Haft, et al., 2006). In at least six species, a gene encoding what appears to be a dedicated (single target) exosortase is adjacent. In that subset, the PEP-CTERM motif takes the form VPEPxxWxL.
Statistics
?
PSSM-Id: 131967
View PSSM: TIGR02921
Aligned: 2 rows
Threshold Bit Score: 1637.84
Threshold Setting Gi: 17130737
Created: 8-Oct-2014
Updated: 11-Oct-2014
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737    9 VKSFWNASFEGIFWLWNLTFLSLVYLGILPFVGVPLVLATARGDIPIEFSLALVTLIAVPTISSIIGGWCFLQQPVKLIR 88
gi 499719457   6 LPGWLAVCCYLLFWFWNLTYAVLTGVLIVPFFTLPAISGAFIGLHSWMTAVFSILLVAIPALCIGLGLTRFRKNPTALIK 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737   89 LFYGVEAPLFVLCLLRLFLIRELTPASSQILLTMGVCIAAFAGELFWGYASRRKIglqWVQMLAHTLMLVFGIYAGAVLL 168
gi 499719457  86 LFYGVEMPIIFIMLSTLFLLRELNPGVTHVLINILIALFAYLACLWGGVNTRFPM---WLRLSLAMTMLLTGLYCALLLA 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737  169 FYALPLAV--FLLQELVKFEWVIPLWN-ILYHTAFVGGLfiismwlivlaFSATLFILMPSALTAMYVHSGAKILKAFAS 245
gi 499719457 163 QFFIPATAgfFELLGEIELRHLGDIFNyLLFLVALICGL-----------STCVVFLALPFVLTFLYIREFLREWRIADA 231
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737  246 EHGNKKAFAGASAVIVAFAVTFLSLQQQPQVMAFSLLANAPKNDSDRQTLIT----KSEQIRTGLLNAYLSSYRYLSSRE 321
gi 499719457 232 SLGRAKAGAVAAGILALNALLFAVLNQQPQQETFERMAFLDQRFQPGETIPSipreEHDALRKGLINAYLAPYRYLSTTE 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737  322 ENNHISAMYRHVL-GLEKTAADGLQETYNFLMSPFLYNGS--DKDVAKAEKLYAEFFDTPLQKAEKTAVSHAVQSTFNEQ 398
gi 499719457 312 RNGAVFNAYLGAFdSADHSLAKGSQAIFNFLATPFLYDGAyfREDKERAARYYRAFFDQPIEKGEPEAILHAIQATFDQG 391
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737  399 EVKAGLLNINEKKVLLASQQVTVKEHGDWADVELYEVYKNQTPEVQEVFYSFSLPESAVITGLWLGDTNKLDQRFNFVVS 478
gi 499719457 392 QPVAGLLDVLNRYVLITNMAITVEPQGDNARIRIVQTLENQTYNNHEVTFHFSLPEEAALTGLWLSDDAKDLDKFAYALA 471
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737  479 PRGAAQKVYNSQVRRErpVDPALLEQVGPRHYRLRAFPIPP------NNVQQIEGQPPLPTEMNLWLTYKVLGQDKG-WA 551
gi 499719457 472 PRGAAQQVYNDEVQQR--IDPSLLEQVGPRQYRLRAFPVPPrranynRSMGLLLGTDYEVDPMYLTFEYKTTINDQGaWP 549
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737  552 MPDLGERRNIFWTNQTKRIRNGKEIGFKENAWLEEFIPASQKIQPALHEVSLdEGYKILAKPLSNKD--YTLPKN-QRVA 628
gi 499719457 550 LPQLLEKRNAYWSDQTQRTLNDQPLQTEKDAWLPITAQMSAAAPRKQHDAVV-AGQRVRAVPRTGADaqWDIQKStTPYA 628
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737  629 LVLDTSRSMGEHIKELTQTLSWLKQHGFADNDLTNNDADLYISVSPGATptrldnlqqfqpekvAFYGTIQPQEMLAQFN 708
gi 499719457 629 ILIDGSYSMGEQAGNVTTALKQLQQLDVAHEIFLCRERCQSITAPPSAD---------------EFYGDSLPMNQLAAWR 693
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737  709 NlRGDTAYDAVLLLSDEGSYELSKNNKTVPATPAPLWMVHLGG-LPGAYNDGIIKSLQDSGGGVAVDIAEVL--QRIATK 785
gi 499719457 694 R-KVKQNYDAVVLLTDAGSYELESQFTLKADQMPPVWLVHLGEtLAYAYHDKTLDLLKQSHGGVALSLQEAIaaHQFRQK 772
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 17130737  786 SILGDSVVTVVNGYAWYLQT---LDTAVTTNNQQDDLLP-LAARQLILGLSKQIKLDNLKSLDAIHAVAKKYKIVSPYSS 861
gi 499719457 773 RATDTGLFAVTQHYLWYAEAgadAEAVLSNAKTEADFFSaIAARRWLEYLAQTRDVSDVKVLDELHAIAKAEHLVTDYSS 852
                        890       900       910       920       930       940       950
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 17130737  862 MLVLVNDEQRQLLKEAEAASDRFDRKVENGKENLSKPNNPLKVS-VPEPSGGWLLGVSAIAL--FIFAKRRR 930
gi 499719457 853 MIVLVEERQKKALEEAEQKADRFDREVETGQETFSAPMDMFSASpVPEPEEWILLGLAGLMLgfAVLNRKRR 924
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap