Conserved Protein Domain Family
TIGR02922

?
TIGR02922: TIGR02922 
TIGR02922 family protein
Two members of this family are found in Colwellia psychrerythraea 34H and one each in various other species of Colwellia and Shewanella. One member from C. psychrerythraea is of special interest because it is preceded by the same cis-regulatory site as a number of genes that have the PEP-CTERM domain described by TIGR02595. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131968
View PSSM: TIGR02922
Aligned: 4 rows
Threshold Bit Score: 117.983
Threshold Setting Gi: 91792586
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 24349613   1 MQATQATVTVLYYDAPVGLIMHNavLQDLPVSESGRVMIPTSFRKGKSIIAVLEGECKILNSLGERVFA 69
gi 71147977   1 MEQSLTQVTIIYYQVESLELLHE--VKSFPKNHHGRVVLPAEFKKGKSIIAVCEGEITILNKVGDRILS 67
gi 71147258   1 MCEAKRKVTVIYCCDNELALYRK--TQSFNINAYGDMIIPQEFKRGKTIVAVCEGDIDVINSVGDKLVN 67
gi 499814939 12 MAPKTAVVTVLYYEAPAGLIMHNevLTGLTVSESGRVMIPQEFRRGKSIIAVLEGQCTILNSLGERVYS 80
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap