Conserved Protein Domain Family
cis_trans_EpsD

?
TIGR02925: cis_trans_EpsD 
peptidyl-prolyl cis-trans isomerase, EpsD family
Members of this family belong to the peptidyl-prolyl cis-trans isomerase family and are found in loci associated with exopolysaccharide biosynthesis. All members are encoded near a homolog of EpsH, as detected by TIGR02602.
Statistics
?
PSSM-Id: 131971
View PSSM: TIGR02925
Aligned: 5 rows
Threshold Bit Score: 312.898
Threshold Setting Gi: 74057311
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21646651    4 ITSLFFVLLFAILVGCSEKSAQESNSGVAAVVNGVEITNRQIDYFYQRTAMPGMSAe-DSANLKRRILSDLIRIELLAGK 82
gi 82409440   16 ITPLLLPLLVLGLAACDKKESSQPASQVAAKVNSGEISVHQLNYVLARATRNSANSpeNASRIRREVLDRLVDQELAVEQ 95
gi 74057311    9 VSLVLAALVTGCGDKKEEAAADKPASQVAAKVNGTELTVHQVNYALQRIPNLDKDQ---AKPASLQVVRNLVDQELVVQR 85
gi 27597140    4 MKKAVFVAMVVALAACGKSEEKSSSGQVAAIVDGKEISVLQLNQAMKNMPNVTADN---ADAVRKQLLDRLVDQQVVLNK 80
gi 499716511   9 PKFVFLAALTGSLAGCGGAGEATDATQVVAKVNGSEISIHQLNAILAKQPAQGVSS--DTARAR--ALDELVEQQVAYDK 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21646651   83 AKEMKLDNNPDYSMALYAAQKNVLAGLAERKLAGNQAPVTPDQAESVVQNAPQLFAGRKLYVFEEVIFPgVDMPLLESLD 162
gi 82409440   96 AINKKLDRSPEVLMALDNARREILARAYLEQITAATPKPTVEEAKTYYSEHPQLFAERRIYNIQEIVLP-SSAGVADELR 174
gi 74057311   86 ALEEKLDRDPRVVQAVDSARRQILAEAYMARKLGTPSEPSDGEISEYFNSHPEMFAQRKIYRLQEVSIQ-APKEKHDAIR 164
gi 27597140   81 ALEEKVERSAEVISSIEAAKREIITRAYLTNMVSSRIKPSPQQVKAYFDGHPELFSARKVYNLQDIALP-PGTAIPDELK 159
gi 499716511  85 AVELKLDRSPDVVMAIESMKKSIIARAYLQQVIGALSQPSQEEIHQYYQEHPALFAERKLYSLQEIAIE-PRDELLAPLR 163
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 21646651  163 AMATNGAPLSGLLDELKAKKKPFNSSLKALTSEQLPAPILAVLNKLKPNTPQVVRSGDKVsVILVLHDAIPAPLEG 238
gi 82409440  175 EMLDSGKPMEDIAKWLKGKDIKFAAGSATRSAEQIPLEILPKIHPLKPGQGLLIQGPQSI-TLMRIAAAQTAPITE 249
gi 74057311  165 KQLEASKTLNDFLAWLKAENLPAKVGQAVKPAEQLPAAVLPKLAQMPNGQALVANAPNGL-LVLVVADSQAQPVTL 239
gi 27597140  160 ALVERSKGLQEVAEWLKSQNVKFGASSYSRPAEQVPTDALAVLKDQKDGAVLIVPMDGNP-HIVKLIGAIVSPNAL 234
gi 499716511 164 NKVGNAGQLEDIVAWLKAEGVQYRVNAANRSAEQIGLELLTQVARLEDGAMTLFQGPNNY-LVVRVAASQKRPVSE 238
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap