Conserved Protein Domain Family
AhaH

?
TIGR02926: AhaH 
ATP synthase archaeal, H subunit
he A1/A0 ATP synthase is homologous to the V-type (V1/V0, vacuolar) ATPase, but functions in the ATP synthetic direction as does the F1/F0 ATPase of bacteria. The hydrophilic A1 "stalk" complex (AhaABCDEFG) is the site of ATP generation and is coupled to the membrane-embedded proton translocating A0 complex. It is unclear precisely where AhaH fits into these complexes.
Statistics
?
PSSM-Id: 131972
View PSSM: TIGR02926
Aligned: 6 rows
Threshold Bit Score: 41.7547
Threshold Setting Gi: 76557025
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72395102   7 LSEIKKAEESAKSVVDEAIEAKNRRISEARAEAREILKQAEIDAHKAAQDSFKEGEKKILEERDKIITDGEKNALAMSQK 86
gi 24638360  10 LEKIKQAEIKVEEAIRAAEEERKNKILEAKMKAREIIESAEAEAVKVKEDILNSARQQIEAEKEEIRKRETKNIEDYAKK 89
gi 76557025   7 LEQIKEAEGEADDIVAEAEQEREERIAEAREEADSIREEAQEEAQQLKQERLEEAREEIEAEREDILAEGESEREALESR 86
gi 18892105   5 LREIVKAERLAEERIEAAKVEAKKIIQNAREEAKKLEEEILKKAEEEGKRIIESKKAEGEQEAKKIREEGEKEIEELKVK 84
gi 2495860    9 IKEVKLAEEQAVKEIEEAKNRAEQIKAEAIEEAKKLIAEAEEEAKKLVEEMIKKAEEEAKKEAEKILEETEKEIKEIISI 88
gi 2622058   11 ITTIKKAENDADRLIQEAREKSSQLLDDARNRSAELLEKAEREASEKGDEIIAEAEERARKEAIEISGKAKREVETMKSA 90

                ....*
gi 72395102  87 AQANI 91
gi 24638360  90 GKDNI 94
gi 76557025  87 AEENR 91
gi 18892105  85 AEEKF 89
gi 2495860   89 AKVKI 93
gi 2622058   91 AMGKV 95
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap