Conserved Protein Domain Family
anfK_nitrog

?
TIGR02931: anfK_nitrog 
Fe-only nitrogenase, beta subunit
Nitrogenase is the enzyme of biological nitrogen fixation. The most wide-spread and most efficient nitrogenase contains a molybdenum cofactor. This protein family, AnfK, represents the beta subunit of the iron-only alternative nitrogenase. It is homologous to NifK and VnfK, of the molybdenum-containing and the vanadium (V)-containing types, respectively. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131977
View PSSM: TIGR02931
Aligned: 4 rows
Threshold Bit Score: 939.322
Threshold Setting Gi: 19915046
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113856     2 TCEVKEKGRVGTINPIFTCQPAGAQFVSIGIKDCIGIVHGGQGCVMFVRLIFSQHYKESFELASSSLHEDGAVFGACGRV 81
gi 728858     2 TCQVTQKAREGTINPIFTCQPAGAQFASIGIKDCIGIVHGGQGCVMFVRLLISQHMKESFEIASSSVHEDGAVFGALDRV 81
gi 39648358   2 NCQFKPKDRIGTINPIFTCQPAGAQYASIGIKDCIGIVHGGQGCVMFVRLLISQHLKESFEIASSSVHEDGAVFGALDRV 81
gi 19915046   2 SCELKERERPGIINPIFTCQPCGAQYASIGIKDCIAIVHGGQGCVMFVRMLLAQHFKDSFEIASSSLHEDGAVFGALNRV 81
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113856    82 EEAVDVLLSRYPDVKVVPIITTCSTEIIGDDVDGVIKKLNEGLLKEKFPDREVHLIAMHTPSFVGSMISGYDVAVRDVVR 161
gi 728858    82 ETAVEVLLTRYPDVKVVPIITTCSTEIIGDDVDGLLSKLEDELLPTKFPGREVHLLTVHCPSFVGSMITGYDKAVHDFVK 161
gi 39648358  82 EEAVDVLLMRYPHVKVVPIITTCSTEVIGDDVDGVVTKLQEELLDVKYPDREVHLIPIHCPSFVGSMVTGYDVAVRDFVK 161
gi 19915046  82 EEAVDVLLTRYPRVKVVPIITTCSTEVIGDDIDGLIRKLNKKLLKEKYADREVHLIPIHTPSFKGSMVTGYDVAVHDIVK 161
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113856   162 HFAKREAPNDKINLLTGWVNPGDVKELKHLLGEMDIEANVLFEIESFDSPILPDGSAVSHGNTTIEDLIDTGNARATFAL 241
gi 728858   162 KFATKDEPSDKINLITGWVNPGDVKELKHLLEVMEVKANVLFEVESFDSPLMPDLEHHSHGSTTIEDLRDTANAKGTIAL 241
gi 39648358 162 HFSKKDKPSLKINLITGWVNPGDVKELKHLLAEMQVEANVLFEIESFDSPLMPDKSAVSHGSTTIADLTATADAQGTIAL 241
gi 19915046 162 EFAKKDKPNGKINLITGWVNPGDVTALKHLLSAMDIDATVLFEIESFDSPLMPDKSGVAHGSTTIEDLTGTANATGTIAL 241
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113856   242 NRYEGTKAAEYLQKKFEIPAIIGPTPIGIRNTDIFLQNLKKATGKPIPQSLAHERGVAIDALADLTHMFLAEKRVAIYGA 321
gi 728858   242 NRYEGMKAADYLKKKFKVPAVIGPTPVGIRNTDAFLKAVSEMTGQPIPAQLVKERGLALDAIADIGHMFLADKRVAIYAN 321
gi 39648358 242 NRYEGGLAATWLQTRWDVPAVIGPTPIGIRNTDTFLRNVKEMTGKPIPESLVKERGIALDAITDLAHMFLADKKVAIYGN 321
gi 19915046 242 NRYEGAKAAKYLESEFDVPAIIGPTPIGIRNTDTFLQNLKKMTGKPIPESLVCERGIAIDAITDLTHMFFADKKVAIYGN 321
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113856   322 PDLVIGLAEFCLDLEMKPVLLLLGDDNSKYVDDPRIKALQENVDyGMEIVTNADFWELENRIKnEGLELDLILGHSKGRF 401
gi 728858   322 PDLAIGLTEFCLDLEMKPKLLLLGDDNSGYVKDPRVVALQENAP-DLEIVTNADFWDLESRIQ-QGLELDLILGHSKGRF 399
gi 39648358 322 PDLVLGLAEYCLDLEMKPVLLLLGDENAGYANDPRIAALKANVDyPMEIITNADLFELEERIKnG-LELDLILGHSKGRF 400
gi 19915046 322 PDLVIGLAEFCLDMEMKPMVLLLGDDNKTYPDDPRIKELQEKVDfDMEIIMNADMWELERRIKdKEIELDLIMGHSKGRW 401
                       410       420       430       440       450       460
                ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 113856   402 ISIDYNIPMLRVGFPTYDRAGLFRYPTVGYGGAIWLAEQMANTLFADMEHKKNKEWVLNVW 462
gi 728858   400 ISIDYKVPMVRVGFPTYDRAGMYRHPVLGYGGAMFLAETMANTLFADMEAKKNKEWILNVW 460
gi 39648358 401 VAIDYNIPMLRVGFPTYDRAGLYRYPVVGYAGATWLAEQMANTLFNDMEVKKNREWILNVW 461
gi 19915046 402 TAIDNNIPMVRVGFPTFDRAGMYRHPVVGYEGAIWLAEQMANTLFADMEYKKDREWILNVW 462
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap