Conserved Protein Domain Family
nifM_nitrog

?
TIGR02933: nifM_nitrog 
nitrogen fixation protein NifM
Members of this protein family, found in a subset of nitrogen-fixing bacteria, are the nitrogen fixation protein NifM. NifM, homologous to peptidyl-prolyl cis-trans isomerases, appears to be an accessory protein for NifH, the Fe protein, also called component II or dinitrogenase reductase, of nitrogenase. [Central intermediary metabolism, Nitrogen fixation]
Statistics
?
PSSM-Id: 131979
View PSSM: TIGR02933
Aligned: 4 rows
Threshold Bit Score: 355.693
Threshold Setting Gi: 49612391
Created: 8-Oct-2014
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49612391   6 RFSEWRLAQKMWNTTATQLPVDRQRLLQQQLARQLLLEQAVVEAAQNSLSTVTPDLVQAV----------TQELEPDLRQ 75
gi 1480131    8 RYSRWKLAKQMKLSEELNPTPAQYQQFIEAWQRQQVIEEAVAQAALEHALNIEPQSVEVT----------RQALAAELPE 77
gi 61228635   6 RFARQRLARSRWNRDPAALDPADTPAFEQAWQRQCHMEQTIVARVPEG--DIPAALLENI----------AASLAIWLDE 73
gi 128298    12 RYYLLKVAHEQFGCAPGELSEDQLQQADRIIGRQRHIEDAVLRSPDAIGVVIPPSQLEEAwahiasryesPEALQQALDA 91
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49612391  76 SGFSASDRTAVIQHHVLMAGQLASISEQVAVPTSAEVEQWYRRHAARFCRPEQRLTRHLLLTTgED----DSEAISRQLL 151
gi 1480131   78 LELTATETEELLLHQTLLREQLNWVQQQAPQPDDAQVEAWYRGHAQHFVRPEQRYTRHLLLTV-EG----NSPAVREQID 152
gi 61228635  74 GDFAPPERAAIVRHHARLELAFADIARQAPQPDLSTVQAWYLRHQTQFMRPEQRLTRHLLLTV-DN----DREAVHQRIL 148
gi 128298    92 QALDAAGMRAMLARELRVEAVLDCVCAGLPEISDTDVSLYYFNHAEQFKVPAQH-KAHILVTInEDfpenTREAARTRIE 170
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49612391 152 ALRRQLQSDTAAFATLAERHSQCPTALEGGLLGWVSRGLLFTSLDQALFTLHEGELSAIIETDIGWHLLLCEAIRPETPM 231
gi 1480131  153 AIARRLRDGHALFARQALRYSHCPSAMGGGVLGWVGRGILYPQLEDTLFRLEAGQLSSPVETELGWHLLLCEQIRLPQPL 232
gi 61228635 149 GLYRQINASRDAFAPLAQRHSHCPSALEEGRLGWISRGLLYPQLETALFSLAENALSLPIASELGWHLLWCEAIRPAAPM 228
gi 128298   171 TILKRLRGKPERFAEQAMKHSECPTAMQGGLLGEVVPGTLYPELDACLFQMARGELSPVLESPIGFHVLYCESVSPARQL 250
                       250       260       270
                ....*....|....*....|....*....|
gi 49612391 232 AQEDALAKAYDHLLLQRQKEQQRQWLVQLV 261
gi 1480131  233 PKAEALTRVRQQLIARQQNHYQRQWLQQLI 262
gi 61228635 229 EPQQALESARDYLWQQSQQRHQRQWLEQMI 258
gi 128298   251 TLEEILPRLRDRLQLRQRKAYQRKWLVCLL 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap